Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0V2K6

Protein Details
Accession A0A4U0V2K6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-38RYSPTFTPRKRTTKRKTAGSNVHydrophilic
NLS Segment(s)
PositionSequence
25-33RKRTTKRKT
Subcellular Location(s) mito 19.5, mito_nucl 12, cyto 4
Family & Domain DBs
Amino Acid Sequences MSLFRKAHARSLRAPVRYSPTFTPRKRTTKRKTAGSNVPITTHKRKSTKAKAVWLPAVSATTCKAKRPVVVNKFKTNRVTRSQGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.52
4 0.49
5 0.48
6 0.43
7 0.44
8 0.5
9 0.5
10 0.56
11 0.56
12 0.65
13 0.7
14 0.76
15 0.77
16 0.77
17 0.82
18 0.82
19 0.8
20 0.78
21 0.78
22 0.72
23 0.68
24 0.57
25 0.52
26 0.46
27 0.44
28 0.43
29 0.39
30 0.39
31 0.38
32 0.43
33 0.51
34 0.59
35 0.63
36 0.62
37 0.65
38 0.64
39 0.65
40 0.63
41 0.53
42 0.43
43 0.34
44 0.29
45 0.21
46 0.16
47 0.14
48 0.18
49 0.18
50 0.21
51 0.26
52 0.27
53 0.33
54 0.4
55 0.49
56 0.52
57 0.62
58 0.66
59 0.71
60 0.73
61 0.74
62 0.75
63 0.72
64 0.69
65 0.66