Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0VGQ3

Protein Details
Accession A0A4U0VGQ3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-84GELRKSTRTRKVGKKAVKDGKVBasic
NLS Segment(s)
PositionSequence
70-77RTRKVGKK
Subcellular Location(s) cyto 18, mito 9, cyto_nucl 9, cyto_pero 9
Family & Domain DBs
Amino Acid Sequences MPRVTRAMAADFADKLHVDEDVVLALPTDLVDAAYASLKTPEPADRAPLGDIAPNRGGNAEDGELRKSTRTRKVGKKAVKDGKVDLAGSIAEEDDTSETGTGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.12
4 0.1
5 0.08
6 0.08
7 0.08
8 0.07
9 0.07
10 0.06
11 0.05
12 0.05
13 0.05
14 0.04
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.04
21 0.05
22 0.05
23 0.05
24 0.07
25 0.07
26 0.07
27 0.09
28 0.1
29 0.13
30 0.13
31 0.16
32 0.16
33 0.16
34 0.17
35 0.16
36 0.14
37 0.13
38 0.12
39 0.12
40 0.13
41 0.12
42 0.12
43 0.11
44 0.11
45 0.1
46 0.11
47 0.09
48 0.09
49 0.1
50 0.12
51 0.12
52 0.12
53 0.14
54 0.17
55 0.23
56 0.3
57 0.38
58 0.45
59 0.55
60 0.65
61 0.72
62 0.78
63 0.8
64 0.81
65 0.83
66 0.8
67 0.72
68 0.65
69 0.61
70 0.55
71 0.46
72 0.35
73 0.26
74 0.2
75 0.18
76 0.15
77 0.09
78 0.06
79 0.06
80 0.07
81 0.07
82 0.08
83 0.08