Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0V4J4

Protein Details
Accession A0A4U0V4J4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
24-43NKKDIERKAREQRKEKVKEEBasic
NLS Segment(s)
PositionSequence
29-44ERKAREQRKEKVKEER
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, mito 6
Family & Domain DBs
Amino Acid Sequences MYQYCLYKRQAEKEGMMRVVDIMNKKDIERKAREQRKEKVKEERRLVKDQELDTQLATLKEAKMAGGGLDGGVAAVGRGSGNGGSGGGEAKPWWKVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.5
3 0.44
4 0.36
5 0.3
6 0.27
7 0.25
8 0.22
9 0.18
10 0.19
11 0.2
12 0.21
13 0.27
14 0.3
15 0.35
16 0.39
17 0.47
18 0.54
19 0.62
20 0.71
21 0.72
22 0.76
23 0.79
24 0.8
25 0.77
26 0.77
27 0.77
28 0.77
29 0.78
30 0.78
31 0.73
32 0.7
33 0.67
34 0.6
35 0.55
36 0.47
37 0.43
38 0.35
39 0.3
40 0.24
41 0.22
42 0.18
43 0.13
44 0.13
45 0.1
46 0.08
47 0.09
48 0.09
49 0.08
50 0.07
51 0.07
52 0.07
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.03
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.07
74 0.06
75 0.07
76 0.07
77 0.1