Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0UNB1

Protein Details
Accession A0A4U0UNB1    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
71-100SSPAEGAKGPRKARKPRKKGSPVKEQDEEHBasic
161-181DQVPPRQRREHEEYRKKRDADBasic
NLS Segment(s)
PositionSequence
76-93GAKGPRKARKPRKKGSPV
Subcellular Location(s) nucl 14, mito 10, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018545  Btz_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0035145  C:exon-exon junction complex  
GO:0003729  F:mRNA binding  
GO:0006397  P:mRNA processing  
GO:0051028  P:mRNA transport  
GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
GO:0006417  P:regulation of translation  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF09405  Btz  
Amino Acid Sequences MAAGRALKSLVGRRRRIGDEGEEDDGPVTIADSQSEGSVLSDGDEDDASSMAEPGAAEGDGGDALAAKSASSPAEGAKGPRKARKPRKKGSPVKEQDEEHKKAETVPLSFKATADTQAMLHGLHIDDTATAQEALNFEAMDRDTASTLAVSTSMVPNGSADQVPPRQRREHEEYRKKRDADPAFVPNRGNFFMHDTRAHIHGQPPPAIRGGFVGRGRGRGGPNVGGPFSPASQMAQAERAAEQPWKHDLHDTINEESAPPAVKPTDASQQRDREDSARLFPTPMPLPGQAQPRVINFSATTLVGKVQIRVLLPGAKAPIAFSEVPWRHYVRLPNHRPPLRRDKPVRISLPEKTPHYIFPSSDRSFIFIPRQQRPNQHGYPRGGSFQRGGGGTGGYSSRRTSAYGGSVYASSMAGSRRSSMAGISRADAFSPASFASGMPPPNRSVGRMPQHGRPSFSAVTTPSGPLSGRHTPVGMPMIHTYPLPQQPTYQGTPTSTMHQPRPQKTISVTGIESPAALLQKVPSNEAPVQPFASQLPAHMAQASAYALQQQQPYYSPRQHYAYPVHPQAGTPLSGIPEQAMHVQFYQPQMPYSQPASYYAPYPPPQQQQFYYSPPGPVDGYAPASMPTYMPPPQGYHAMPPPGLQQMSMQMPTQLSAQEQYMPPQPMESQPRQDTGQEPQPSSNLPDSGMMAHESNGMVFYVPRSDIQEQQGGERNLHQDYQPAESFVPSYAMPGLPPPTPAPEMSTQGYYYPSVQQQMGMGMQDGTGYYAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.61
4 0.58
5 0.57
6 0.55
7 0.53
8 0.51
9 0.43
10 0.39
11 0.35
12 0.29
13 0.21
14 0.13
15 0.09
16 0.07
17 0.07
18 0.07
19 0.08
20 0.09
21 0.09
22 0.09
23 0.09
24 0.08
25 0.08
26 0.08
27 0.07
28 0.08
29 0.08
30 0.09
31 0.09
32 0.08
33 0.08
34 0.08
35 0.07
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.07
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.06
53 0.06
54 0.05
55 0.06
56 0.08
57 0.08
58 0.09
59 0.1
60 0.09
61 0.13
62 0.15
63 0.2
64 0.27
65 0.35
66 0.41
67 0.49
68 0.58
69 0.65
70 0.75
71 0.81
72 0.84
73 0.86
74 0.91
75 0.93
76 0.94
77 0.92
78 0.92
79 0.9
80 0.87
81 0.83
82 0.74
83 0.73
84 0.72
85 0.67
86 0.58
87 0.52
88 0.44
89 0.39
90 0.43
91 0.37
92 0.31
93 0.32
94 0.34
95 0.36
96 0.36
97 0.34
98 0.31
99 0.28
100 0.27
101 0.23
102 0.2
103 0.15
104 0.16
105 0.16
106 0.13
107 0.12
108 0.11
109 0.09
110 0.08
111 0.08
112 0.07
113 0.07
114 0.07
115 0.08
116 0.07
117 0.08
118 0.07
119 0.09
120 0.09
121 0.1
122 0.1
123 0.1
124 0.08
125 0.1
126 0.11
127 0.1
128 0.1
129 0.1
130 0.1
131 0.1
132 0.11
133 0.08
134 0.08
135 0.07
136 0.06
137 0.06
138 0.07
139 0.08
140 0.08
141 0.08
142 0.08
143 0.09
144 0.1
145 0.11
146 0.1
147 0.1
148 0.15
149 0.22
150 0.31
151 0.37
152 0.41
153 0.46
154 0.49
155 0.57
156 0.61
157 0.65
158 0.67
159 0.73
160 0.77
161 0.81
162 0.86
163 0.79
164 0.75
165 0.73
166 0.68
167 0.64
168 0.6
169 0.6
170 0.54
171 0.54
172 0.51
173 0.42
174 0.4
175 0.34
176 0.29
177 0.2
178 0.24
179 0.26
180 0.28
181 0.27
182 0.26
183 0.26
184 0.28
185 0.29
186 0.24
187 0.24
188 0.26
189 0.28
190 0.31
191 0.31
192 0.3
193 0.3
194 0.28
195 0.24
196 0.22
197 0.21
198 0.22
199 0.2
200 0.26
201 0.25
202 0.27
203 0.28
204 0.29
205 0.29
206 0.26
207 0.28
208 0.23
209 0.25
210 0.25
211 0.24
212 0.2
213 0.19
214 0.17
215 0.14
216 0.13
217 0.1
218 0.09
219 0.1
220 0.12
221 0.11
222 0.12
223 0.12
224 0.12
225 0.12
226 0.13
227 0.13
228 0.15
229 0.15
230 0.15
231 0.2
232 0.21
233 0.21
234 0.23
235 0.24
236 0.26
237 0.33
238 0.33
239 0.29
240 0.28
241 0.28
242 0.25
243 0.23
244 0.18
245 0.12
246 0.08
247 0.09
248 0.08
249 0.08
250 0.1
251 0.12
252 0.2
253 0.25
254 0.3
255 0.36
256 0.42
257 0.44
258 0.44
259 0.43
260 0.36
261 0.36
262 0.33
263 0.3
264 0.26
265 0.24
266 0.24
267 0.23
268 0.25
269 0.21
270 0.2
271 0.19
272 0.17
273 0.19
274 0.22
275 0.28
276 0.26
277 0.27
278 0.28
279 0.26
280 0.3
281 0.27
282 0.24
283 0.18
284 0.17
285 0.16
286 0.14
287 0.13
288 0.09
289 0.09
290 0.12
291 0.12
292 0.11
293 0.11
294 0.13
295 0.13
296 0.13
297 0.14
298 0.13
299 0.13
300 0.13
301 0.13
302 0.11
303 0.11
304 0.1
305 0.1
306 0.1
307 0.1
308 0.09
309 0.19
310 0.19
311 0.21
312 0.24
313 0.24
314 0.23
315 0.26
316 0.33
317 0.32
318 0.42
319 0.48
320 0.55
321 0.63
322 0.66
323 0.66
324 0.66
325 0.68
326 0.64
327 0.66
328 0.64
329 0.64
330 0.67
331 0.72
332 0.69
333 0.62
334 0.59
335 0.54
336 0.54
337 0.49
338 0.42
339 0.36
340 0.34
341 0.31
342 0.32
343 0.29
344 0.23
345 0.23
346 0.3
347 0.29
348 0.3
349 0.29
350 0.26
351 0.25
352 0.26
353 0.26
354 0.21
355 0.27
356 0.3
357 0.36
358 0.37
359 0.44
360 0.47
361 0.51
362 0.53
363 0.52
364 0.52
365 0.49
366 0.49
367 0.43
368 0.4
369 0.33
370 0.28
371 0.23
372 0.18
373 0.17
374 0.13
375 0.13
376 0.1
377 0.09
378 0.08
379 0.08
380 0.07
381 0.06
382 0.07
383 0.07
384 0.08
385 0.09
386 0.1
387 0.11
388 0.12
389 0.14
390 0.14
391 0.14
392 0.13
393 0.12
394 0.11
395 0.1
396 0.08
397 0.05
398 0.06
399 0.07
400 0.08
401 0.08
402 0.09
403 0.09
404 0.1
405 0.1
406 0.1
407 0.13
408 0.14
409 0.14
410 0.14
411 0.15
412 0.14
413 0.14
414 0.14
415 0.1
416 0.07
417 0.08
418 0.07
419 0.06
420 0.06
421 0.06
422 0.08
423 0.1
424 0.13
425 0.13
426 0.15
427 0.15
428 0.19
429 0.19
430 0.2
431 0.21
432 0.26
433 0.32
434 0.38
435 0.4
436 0.42
437 0.51
438 0.5
439 0.49
440 0.42
441 0.41
442 0.34
443 0.32
444 0.27
445 0.2
446 0.21
447 0.19
448 0.18
449 0.12
450 0.12
451 0.12
452 0.12
453 0.17
454 0.18
455 0.19
456 0.19
457 0.19
458 0.19
459 0.21
460 0.23
461 0.17
462 0.14
463 0.14
464 0.15
465 0.15
466 0.14
467 0.14
468 0.16
469 0.21
470 0.21
471 0.2
472 0.2
473 0.24
474 0.29
475 0.29
476 0.26
477 0.22
478 0.21
479 0.24
480 0.24
481 0.24
482 0.24
483 0.26
484 0.29
485 0.35
486 0.42
487 0.43
488 0.48
489 0.44
490 0.42
491 0.4
492 0.43
493 0.39
494 0.34
495 0.3
496 0.26
497 0.25
498 0.22
499 0.2
500 0.12
501 0.11
502 0.08
503 0.08
504 0.07
505 0.07
506 0.11
507 0.12
508 0.15
509 0.14
510 0.18
511 0.2
512 0.23
513 0.24
514 0.22
515 0.23
516 0.21
517 0.21
518 0.16
519 0.18
520 0.14
521 0.12
522 0.16
523 0.15
524 0.15
525 0.14
526 0.14
527 0.11
528 0.12
529 0.12
530 0.07
531 0.07
532 0.09
533 0.09
534 0.12
535 0.14
536 0.14
537 0.14
538 0.17
539 0.21
540 0.25
541 0.31
542 0.31
543 0.33
544 0.36
545 0.37
546 0.4
547 0.42
548 0.42
549 0.43
550 0.43
551 0.4
552 0.37
553 0.35
554 0.33
555 0.29
556 0.23
557 0.16
558 0.14
559 0.14
560 0.14
561 0.14
562 0.11
563 0.09
564 0.09
565 0.13
566 0.13
567 0.13
568 0.13
569 0.14
570 0.16
571 0.18
572 0.21
573 0.17
574 0.17
575 0.18
576 0.19
577 0.21
578 0.22
579 0.21
580 0.18
581 0.21
582 0.24
583 0.23
584 0.24
585 0.23
586 0.26
587 0.27
588 0.31
589 0.34
590 0.38
591 0.42
592 0.45
593 0.44
594 0.45
595 0.47
596 0.47
597 0.47
598 0.4
599 0.37
600 0.33
601 0.33
602 0.27
603 0.23
604 0.2
605 0.15
606 0.17
607 0.15
608 0.15
609 0.13
610 0.14
611 0.14
612 0.12
613 0.11
614 0.13
615 0.15
616 0.17
617 0.18
618 0.2
619 0.22
620 0.27
621 0.26
622 0.28
623 0.31
624 0.32
625 0.3
626 0.29
627 0.29
628 0.29
629 0.28
630 0.23
631 0.18
632 0.2
633 0.23
634 0.24
635 0.21
636 0.18
637 0.19
638 0.19
639 0.19
640 0.15
641 0.12
642 0.12
643 0.13
644 0.16
645 0.16
646 0.19
647 0.25
648 0.26
649 0.25
650 0.25
651 0.26
652 0.29
653 0.36
654 0.39
655 0.41
656 0.42
657 0.46
658 0.46
659 0.47
660 0.42
661 0.41
662 0.44
663 0.41
664 0.4
665 0.38
666 0.38
667 0.37
668 0.39
669 0.35
670 0.27
671 0.22
672 0.21
673 0.21
674 0.2
675 0.19
676 0.17
677 0.13
678 0.13
679 0.14
680 0.12
681 0.11
682 0.11
683 0.1
684 0.08
685 0.08
686 0.09
687 0.1
688 0.11
689 0.13
690 0.18
691 0.21
692 0.27
693 0.31
694 0.35
695 0.32
696 0.36
697 0.43
698 0.38
699 0.37
700 0.35
701 0.34
702 0.31
703 0.33
704 0.28
705 0.25
706 0.26
707 0.31
708 0.27
709 0.26
710 0.24
711 0.23
712 0.24
713 0.19
714 0.19
715 0.13
716 0.13
717 0.13
718 0.13
719 0.13
720 0.15
721 0.18
722 0.16
723 0.19
724 0.2
725 0.23
726 0.25
727 0.25
728 0.27
729 0.28
730 0.32
731 0.32
732 0.33
733 0.28
734 0.27
735 0.29
736 0.25
737 0.23
738 0.24
739 0.25
740 0.26
741 0.26
742 0.26
743 0.25
744 0.26
745 0.25
746 0.2
747 0.17
748 0.13
749 0.13
750 0.12
751 0.11