Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0VL17

Protein Details
Accession A0A4U0VL17    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
173-199DGMGERAPRRQNKKRSQARKASPYRGAHydrophilic
243-264STPSSQSSSKQGRRQSRFREVGHydrophilic
NLS Segment(s)
PositionSequence
177-193ERAPRRQNKKRSQARKA
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020592  Ribosomal_S16_CS  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
PROSITE View protein in PROSITE  
PS00732  RIBOSOMAL_S16  
Amino Acid Sequences MPFFHPNPTKSTSASIRTYVKVRLTRLGARINRSRHGRVTATRSVADTDAIPSIGGTWLRRQQAGESEAGRVSSPASRDQAQEAWHAGLEVDADASGNTEEVNGLLLASTLPLPSLSSPQSDEAGEDADSMVGAEHQELLSAWWGRPKSIPSDDGSVVSGEELRGRRRQAWWDGMGERAPRRQNKKRSQARKASPYRGAASQQVNGNGVTQEAWYASSTRLDGPETVTSTPATSSETITAIPSTPSSQSSSKQGRRQSRFREVGLVEKPVETE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.44
4 0.45
5 0.46
6 0.45
7 0.46
8 0.45
9 0.45
10 0.46
11 0.48
12 0.5
13 0.52
14 0.56
15 0.53
16 0.55
17 0.6
18 0.58
19 0.61
20 0.61
21 0.61
22 0.56
23 0.57
24 0.56
25 0.55
26 0.57
27 0.56
28 0.53
29 0.49
30 0.44
31 0.4
32 0.35
33 0.29
34 0.21
35 0.16
36 0.13
37 0.12
38 0.11
39 0.08
40 0.09
41 0.1
42 0.11
43 0.1
44 0.15
45 0.21
46 0.24
47 0.25
48 0.25
49 0.26
50 0.31
51 0.32
52 0.3
53 0.25
54 0.25
55 0.24
56 0.24
57 0.21
58 0.14
59 0.13
60 0.12
61 0.12
62 0.14
63 0.17
64 0.19
65 0.2
66 0.22
67 0.24
68 0.23
69 0.23
70 0.21
71 0.18
72 0.16
73 0.15
74 0.12
75 0.09
76 0.08
77 0.06
78 0.04
79 0.03
80 0.04
81 0.03
82 0.04
83 0.04
84 0.04
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.03
98 0.03
99 0.03
100 0.04
101 0.05
102 0.07
103 0.08
104 0.09
105 0.1
106 0.12
107 0.13
108 0.12
109 0.12
110 0.1
111 0.1
112 0.09
113 0.07
114 0.06
115 0.05
116 0.05
117 0.04
118 0.04
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.04
127 0.06
128 0.07
129 0.07
130 0.1
131 0.11
132 0.11
133 0.13
134 0.14
135 0.17
136 0.19
137 0.21
138 0.2
139 0.24
140 0.24
141 0.23
142 0.22
143 0.16
144 0.13
145 0.11
146 0.1
147 0.06
148 0.09
149 0.1
150 0.13
151 0.16
152 0.18
153 0.21
154 0.24
155 0.31
156 0.33
157 0.38
158 0.37
159 0.37
160 0.36
161 0.35
162 0.34
163 0.31
164 0.27
165 0.27
166 0.31
167 0.35
168 0.44
169 0.52
170 0.6
171 0.68
172 0.77
173 0.81
174 0.85
175 0.88
176 0.89
177 0.88
178 0.88
179 0.86
180 0.83
181 0.78
182 0.72
183 0.65
184 0.57
185 0.5
186 0.45
187 0.4
188 0.36
189 0.32
190 0.29
191 0.28
192 0.24
193 0.23
194 0.17
195 0.14
196 0.11
197 0.08
198 0.07
199 0.06
200 0.07
201 0.07
202 0.08
203 0.09
204 0.1
205 0.12
206 0.13
207 0.14
208 0.14
209 0.14
210 0.17
211 0.2
212 0.21
213 0.21
214 0.2
215 0.19
216 0.18
217 0.18
218 0.15
219 0.14
220 0.12
221 0.13
222 0.14
223 0.14
224 0.14
225 0.15
226 0.15
227 0.12
228 0.12
229 0.12
230 0.13
231 0.14
232 0.15
233 0.19
234 0.21
235 0.24
236 0.32
237 0.42
238 0.48
239 0.54
240 0.61
241 0.68
242 0.73
243 0.81
244 0.81
245 0.81
246 0.79
247 0.74
248 0.73
249 0.64
250 0.64
251 0.58
252 0.53
253 0.43