Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0V242

Protein Details
Accession A0A4U0V242    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPSKLSKVQKHVTKKKGSKINSLHydrophilic
NLS Segment(s)
PositionSequence
14-17KKKG
Subcellular Location(s) nucl 16, cyto 7.5, cyto_mito 6, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021346  Tma16  
IPR038356  Tma16_sf  
Pfam View protein in Pfam  
PF11176  Tma16  
Amino Acid Sequences MPSKLSKVQKHVTKKKGSKINSLHENSRDAKRLRNAGARDDRVARLGAVREKANRQWLERVFFLQDRLPDTLHPLDVEAIQALITEFLKRNDKEIEQLKAERRVGRPPSTRFTMLEQEKKVEGKEYESGFWVPNLRDEETLTRLDGWKGDWISLANLRFLRVDAGGLVKESQFPPRGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.84
4 0.8
5 0.79
6 0.78
7 0.77
8 0.77
9 0.74
10 0.7
11 0.64
12 0.64
13 0.57
14 0.54
15 0.53
16 0.44
17 0.46
18 0.47
19 0.52
20 0.52
21 0.56
22 0.52
23 0.54
24 0.62
25 0.57
26 0.54
27 0.5
28 0.45
29 0.38
30 0.36
31 0.27
32 0.2
33 0.21
34 0.22
35 0.21
36 0.23
37 0.25
38 0.29
39 0.33
40 0.39
41 0.38
42 0.36
43 0.41
44 0.42
45 0.42
46 0.39
47 0.37
48 0.31
49 0.29
50 0.28
51 0.22
52 0.2
53 0.19
54 0.2
55 0.18
56 0.15
57 0.19
58 0.18
59 0.16
60 0.14
61 0.12
62 0.11
63 0.11
64 0.11
65 0.06
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.06
74 0.08
75 0.14
76 0.14
77 0.17
78 0.19
79 0.19
80 0.24
81 0.27
82 0.28
83 0.25
84 0.29
85 0.3
86 0.34
87 0.36
88 0.35
89 0.32
90 0.37
91 0.4
92 0.44
93 0.48
94 0.46
95 0.49
96 0.48
97 0.48
98 0.42
99 0.4
100 0.41
101 0.4
102 0.42
103 0.38
104 0.36
105 0.36
106 0.36
107 0.32
108 0.28
109 0.22
110 0.19
111 0.24
112 0.23
113 0.22
114 0.23
115 0.24
116 0.2
117 0.2
118 0.2
119 0.15
120 0.18
121 0.21
122 0.2
123 0.2
124 0.22
125 0.25
126 0.24
127 0.25
128 0.21
129 0.19
130 0.19
131 0.19
132 0.17
133 0.15
134 0.18
135 0.18
136 0.18
137 0.17
138 0.17
139 0.19
140 0.23
141 0.23
142 0.21
143 0.21
144 0.22
145 0.21
146 0.2
147 0.19
148 0.15
149 0.14
150 0.11
151 0.13
152 0.13
153 0.13
154 0.14
155 0.12
156 0.16
157 0.16
158 0.22
159 0.23