Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LP93

Protein Details
Accession E2LP93    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MANPRQRRKARSSSYRPVSHSKNAKRNLKKMPPIHydrophilic
NLS Segment(s)
PositionSequence
5-38RQRRKARSSSYRPVSHSKNAKRNLKKMPPIRAPK
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
KEGG mpr:MPER_08686  -  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MANPRQRRKARSSSYRPVSHSKNAKRNLKKMPPIRAPKVLQEAWDKRKTVRQNYAALGLIHDLNPSASGGAEIIKVDIDQEMPEHSVPKAFTSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.78
4 0.75
5 0.7
6 0.68
7 0.69
8 0.68
9 0.68
10 0.71
11 0.77
12 0.77
13 0.79
14 0.81
15 0.8
16 0.8
17 0.78
18 0.79
19 0.78
20 0.78
21 0.75
22 0.72
23 0.64
24 0.59
25 0.58
26 0.49
27 0.42
28 0.42
29 0.44
30 0.43
31 0.46
32 0.42
33 0.37
34 0.43
35 0.47
36 0.46
37 0.48
38 0.46
39 0.46
40 0.46
41 0.48
42 0.43
43 0.36
44 0.28
45 0.2
46 0.15
47 0.11
48 0.1
49 0.07
50 0.06
51 0.06
52 0.06
53 0.05
54 0.04
55 0.04
56 0.05
57 0.05
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.08
69 0.1
70 0.11
71 0.12
72 0.12
73 0.15
74 0.16