Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0UL05

Protein Details
Accession A0A4U0UL05    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
250-271AGVRVNKRISRPRRGLGCRQRGHydrophilic
NLS Segment(s)
PositionSequence
249-264KAGVRVNKRISRPRRG
Subcellular Location(s) nucl 15, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MTPDARALISHLLGLPPELRIHIYELVLLSQPGDPFLLQSSRQINMEAQPTLYRRPLVFASQANLFLWIDRSRSCNLKRVKSMTLRLTDIDLTPLLCLQHRDTRTSVWDLYQQELERLDRELEVLPKLEHLTIVPPRAMHSHLLRVLYLSFLTSIHQWYPRMERPVVADDEAAFDTSPLRSGSIECPRPAQEMNLIHVARSASPAACTNVGYSVCHGELVATPVSPRPRKGEGSLKSVRSSTGRVSNIKAGVRVNKRISRPRRGLGCRQRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.11
4 0.12
5 0.12
6 0.12
7 0.13
8 0.17
9 0.18
10 0.17
11 0.17
12 0.17
13 0.17
14 0.17
15 0.15
16 0.13
17 0.12
18 0.12
19 0.11
20 0.11
21 0.1
22 0.1
23 0.13
24 0.15
25 0.13
26 0.19
27 0.21
28 0.22
29 0.23
30 0.24
31 0.23
32 0.23
33 0.27
34 0.22
35 0.2
36 0.22
37 0.24
38 0.26
39 0.27
40 0.26
41 0.22
42 0.25
43 0.26
44 0.25
45 0.28
46 0.26
47 0.26
48 0.25
49 0.26
50 0.22
51 0.22
52 0.18
53 0.14
54 0.15
55 0.14
56 0.14
57 0.14
58 0.17
59 0.18
60 0.26
61 0.29
62 0.34
63 0.4
64 0.46
65 0.52
66 0.53
67 0.58
68 0.57
69 0.62
70 0.6
71 0.56
72 0.5
73 0.43
74 0.4
75 0.34
76 0.27
77 0.21
78 0.15
79 0.11
80 0.1
81 0.1
82 0.08
83 0.08
84 0.1
85 0.12
86 0.19
87 0.2
88 0.23
89 0.23
90 0.25
91 0.27
92 0.29
93 0.26
94 0.2
95 0.24
96 0.22
97 0.23
98 0.24
99 0.2
100 0.18
101 0.19
102 0.18
103 0.13
104 0.13
105 0.12
106 0.09
107 0.1
108 0.1
109 0.11
110 0.11
111 0.11
112 0.1
113 0.1
114 0.11
115 0.09
116 0.08
117 0.07
118 0.1
119 0.11
120 0.13
121 0.12
122 0.12
123 0.13
124 0.14
125 0.15
126 0.14
127 0.13
128 0.17
129 0.18
130 0.19
131 0.18
132 0.17
133 0.15
134 0.13
135 0.11
136 0.07
137 0.05
138 0.05
139 0.06
140 0.06
141 0.07
142 0.09
143 0.11
144 0.12
145 0.14
146 0.2
147 0.24
148 0.28
149 0.27
150 0.27
151 0.28
152 0.31
153 0.3
154 0.25
155 0.2
156 0.15
157 0.17
158 0.16
159 0.13
160 0.09
161 0.07
162 0.07
163 0.07
164 0.08
165 0.07
166 0.07
167 0.07
168 0.09
169 0.16
170 0.24
171 0.28
172 0.27
173 0.3
174 0.3
175 0.33
176 0.32
177 0.26
178 0.25
179 0.23
180 0.26
181 0.3
182 0.28
183 0.25
184 0.27
185 0.26
186 0.19
187 0.19
188 0.17
189 0.1
190 0.12
191 0.14
192 0.14
193 0.15
194 0.15
195 0.13
196 0.16
197 0.16
198 0.15
199 0.15
200 0.15
201 0.14
202 0.14
203 0.13
204 0.1
205 0.11
206 0.13
207 0.12
208 0.1
209 0.1
210 0.15
211 0.23
212 0.26
213 0.28
214 0.31
215 0.36
216 0.4
217 0.46
218 0.52
219 0.49
220 0.54
221 0.59
222 0.56
223 0.53
224 0.49
225 0.45
226 0.38
227 0.36
228 0.34
229 0.35
230 0.37
231 0.38
232 0.42
233 0.45
234 0.47
235 0.45
236 0.42
237 0.38
238 0.43
239 0.47
240 0.52
241 0.54
242 0.57
243 0.63
244 0.71
245 0.75
246 0.77
247 0.78
248 0.78
249 0.8
250 0.81
251 0.84