Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LJH2

Protein Details
Accession E2LJH2   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
103-125FEEKEARRLRRQKRLEKAGRDGGBasic
NLS Segment(s)
PositionSequence
106-122KEARRLRRQKRLEKAGR
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR032710  NTF2-like_dom_sf  
IPR039544  Tim44-like  
IPR007379  Tim44-like_dom  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0006886  P:intracellular protein transport  
KEGG mpr:MPER_06759  -  
Pfam View protein in Pfam  
PF04280  Tim44  
Amino Acid Sequences MKKARAAYERARLTSSIKENPRLRAAAEELKKRGIKVGDAVSEALKTMEESEIMRAISRASAAVSSTIDKSTEPIRKTAAYKALSDTLVDALDDSGSAKHAGFEEKEARRLRRQKRLEKAGRDGGLGPASHRVTTDPEYVFIFLPKTQALPWFSIKTLHVKEKWNELKDTNPVLKTFFSLRQAYDESENPIVSSMRSVTQTIGSGFDENETAQVMRMMKVVHVPEVVDAYLSADQKALKAWCGEATYNVLWATMEVYLKQGLISESKVLDIRQVDVHTGKVLDNNVPVFVIQFNTQEVLLFRNAKTREVMVGAEDRVEQCTYIAAITRVEEELGNELTGGWKVIEMGRRSARAYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.47
4 0.47
5 0.54
6 0.57
7 0.62
8 0.64
9 0.57
10 0.5
11 0.47
12 0.46
13 0.46
14 0.49
15 0.5
16 0.47
17 0.53
18 0.54
19 0.49
20 0.49
21 0.42
22 0.37
23 0.36
24 0.39
25 0.34
26 0.34
27 0.35
28 0.29
29 0.26
30 0.24
31 0.18
32 0.11
33 0.09
34 0.09
35 0.08
36 0.09
37 0.09
38 0.11
39 0.13
40 0.13
41 0.13
42 0.12
43 0.12
44 0.11
45 0.11
46 0.09
47 0.08
48 0.08
49 0.08
50 0.1
51 0.1
52 0.12
53 0.13
54 0.13
55 0.13
56 0.12
57 0.14
58 0.2
59 0.26
60 0.25
61 0.26
62 0.29
63 0.32
64 0.35
65 0.39
66 0.4
67 0.35
68 0.35
69 0.36
70 0.36
71 0.33
72 0.3
73 0.24
74 0.17
75 0.15
76 0.13
77 0.1
78 0.06
79 0.06
80 0.06
81 0.06
82 0.05
83 0.06
84 0.07
85 0.06
86 0.07
87 0.08
88 0.11
89 0.11
90 0.16
91 0.23
92 0.25
93 0.32
94 0.37
95 0.4
96 0.47
97 0.56
98 0.61
99 0.63
100 0.71
101 0.74
102 0.79
103 0.86
104 0.85
105 0.82
106 0.8
107 0.77
108 0.67
109 0.59
110 0.49
111 0.4
112 0.33
113 0.25
114 0.19
115 0.17
116 0.17
117 0.16
118 0.15
119 0.14
120 0.16
121 0.2
122 0.24
123 0.18
124 0.19
125 0.19
126 0.2
127 0.19
128 0.16
129 0.14
130 0.09
131 0.1
132 0.1
133 0.1
134 0.09
135 0.13
136 0.14
137 0.16
138 0.19
139 0.19
140 0.19
141 0.21
142 0.21
143 0.24
144 0.25
145 0.28
146 0.29
147 0.33
148 0.34
149 0.42
150 0.48
151 0.44
152 0.43
153 0.38
154 0.37
155 0.36
156 0.39
157 0.32
158 0.26
159 0.24
160 0.23
161 0.22
162 0.2
163 0.19
164 0.17
165 0.18
166 0.18
167 0.18
168 0.2
169 0.21
170 0.21
171 0.2
172 0.18
173 0.17
174 0.17
175 0.16
176 0.13
177 0.13
178 0.12
179 0.09
180 0.09
181 0.07
182 0.07
183 0.09
184 0.09
185 0.09
186 0.1
187 0.11
188 0.11
189 0.12
190 0.11
191 0.1
192 0.09
193 0.09
194 0.09
195 0.08
196 0.07
197 0.06
198 0.06
199 0.05
200 0.08
201 0.08
202 0.08
203 0.09
204 0.09
205 0.09
206 0.13
207 0.14
208 0.12
209 0.12
210 0.12
211 0.11
212 0.11
213 0.11
214 0.07
215 0.06
216 0.07
217 0.1
218 0.1
219 0.1
220 0.1
221 0.1
222 0.1
223 0.13
224 0.12
225 0.11
226 0.11
227 0.12
228 0.13
229 0.15
230 0.15
231 0.13
232 0.17
233 0.16
234 0.17
235 0.16
236 0.13
237 0.11
238 0.11
239 0.1
240 0.08
241 0.08
242 0.07
243 0.08
244 0.09
245 0.09
246 0.09
247 0.09
248 0.08
249 0.1
250 0.1
251 0.11
252 0.11
253 0.12
254 0.14
255 0.13
256 0.15
257 0.14
258 0.15
259 0.17
260 0.17
261 0.19
262 0.18
263 0.19
264 0.17
265 0.17
266 0.15
267 0.15
268 0.16
269 0.16
270 0.18
271 0.17
272 0.16
273 0.16
274 0.15
275 0.13
276 0.12
277 0.11
278 0.1
279 0.1
280 0.11
281 0.12
282 0.12
283 0.12
284 0.12
285 0.13
286 0.16
287 0.18
288 0.17
289 0.24
290 0.26
291 0.27
292 0.28
293 0.27
294 0.26
295 0.24
296 0.24
297 0.2
298 0.22
299 0.2
300 0.19
301 0.19
302 0.17
303 0.18
304 0.17
305 0.14
306 0.11
307 0.12
308 0.11
309 0.1
310 0.12
311 0.11
312 0.11
313 0.12
314 0.14
315 0.13
316 0.13
317 0.13
318 0.12
319 0.14
320 0.15
321 0.13
322 0.12
323 0.11
324 0.12
325 0.12
326 0.12
327 0.08
328 0.07
329 0.08
330 0.13
331 0.2
332 0.21
333 0.29
334 0.34
335 0.37