Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0V9T3

Protein Details
Accession A0A4U0V9T3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
77-112GKTVRAKKPMKKVPGSRAPGREKRMQRRKEERQGRABasic
NLS Segment(s)
PositionSequence
78-112KTVRAKKPMKKVPGSRAPGREKRMQRRKEERQGRA
Subcellular Location(s) mito 11, extr 6, plas 5, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLQTTRFSNSIVATALKIFGGLFFLLAALTAFDPDYPLAGTCPPMAIGGLLFALPYTGLFDRFMATAGAERTGSTGKTVRAKKPMKKVPGSRAPGREKRMQRRKEERQGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.11
5 0.1
6 0.08
7 0.07
8 0.07
9 0.06
10 0.06
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.05
22 0.05
23 0.06
24 0.05
25 0.06
26 0.06
27 0.07
28 0.08
29 0.07
30 0.07
31 0.07
32 0.06
33 0.06
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.05
47 0.06
48 0.06
49 0.07
50 0.08
51 0.08
52 0.06
53 0.06
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.09
61 0.09
62 0.1
63 0.12
64 0.15
65 0.23
66 0.29
67 0.33
68 0.43
69 0.51
70 0.57
71 0.65
72 0.71
73 0.72
74 0.76
75 0.79
76 0.79
77 0.8
78 0.8
79 0.76
80 0.77
81 0.77
82 0.76
83 0.73
84 0.73
85 0.73
86 0.77
87 0.8
88 0.8
89 0.81
90 0.84
91 0.89
92 0.9