Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0V9G3

Protein Details
Accession A0A4U0V9G3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
215-235RRGLWTQTRRHKKGGKVVEKGBasic
NLS Segment(s)
PositionSequence
223-230RRHKKGGK
Subcellular Location(s) mito 26.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
Amino Acid Sequences MAGRMASRVSARIAARMTIQPDRMHGLEGVANTQNMTTTALATAIQQTSRLLDLPPEIRNTIYHLVLVRECRKRVLAPALPYDPALLRTCRQIRQEAQGIFLHQNTFYITVFNLRYTIPRTHWFHLVAPQNRSVVLAPETKKMQWEHLRDWLKAYHAGEATRLPVPERYLAPDSHKVAARAFVTVDRLGEVKWEVVGEALVDLLEHHRSVGRGFRRGLWTQTRRHKKGGKVVEKGEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.28
4 0.31
5 0.31
6 0.34
7 0.3
8 0.31
9 0.35
10 0.31
11 0.29
12 0.24
13 0.21
14 0.19
15 0.19
16 0.2
17 0.16
18 0.16
19 0.14
20 0.14
21 0.13
22 0.11
23 0.13
24 0.1
25 0.09
26 0.09
27 0.09
28 0.09
29 0.1
30 0.12
31 0.11
32 0.11
33 0.11
34 0.11
35 0.12
36 0.13
37 0.13
38 0.1
39 0.1
40 0.14
41 0.17
42 0.19
43 0.2
44 0.2
45 0.2
46 0.2
47 0.24
48 0.23
49 0.19
50 0.18
51 0.17
52 0.18
53 0.2
54 0.25
55 0.28
56 0.31
57 0.31
58 0.32
59 0.33
60 0.32
61 0.36
62 0.39
63 0.37
64 0.35
65 0.39
66 0.39
67 0.37
68 0.36
69 0.31
70 0.22
71 0.19
72 0.18
73 0.14
74 0.13
75 0.2
76 0.24
77 0.28
78 0.3
79 0.33
80 0.34
81 0.39
82 0.45
83 0.38
84 0.37
85 0.33
86 0.32
87 0.27
88 0.25
89 0.2
90 0.12
91 0.12
92 0.1
93 0.1
94 0.08
95 0.08
96 0.07
97 0.1
98 0.1
99 0.1
100 0.1
101 0.09
102 0.11
103 0.14
104 0.16
105 0.16
106 0.22
107 0.27
108 0.28
109 0.31
110 0.31
111 0.28
112 0.33
113 0.38
114 0.35
115 0.33
116 0.33
117 0.3
118 0.28
119 0.28
120 0.22
121 0.15
122 0.13
123 0.17
124 0.16
125 0.19
126 0.21
127 0.2
128 0.24
129 0.22
130 0.28
131 0.31
132 0.34
133 0.35
134 0.43
135 0.47
136 0.43
137 0.45
138 0.38
139 0.32
140 0.31
141 0.28
142 0.23
143 0.2
144 0.2
145 0.19
146 0.18
147 0.19
148 0.16
149 0.16
150 0.13
151 0.14
152 0.16
153 0.18
154 0.18
155 0.21
156 0.22
157 0.23
158 0.28
159 0.32
160 0.33
161 0.34
162 0.35
163 0.31
164 0.29
165 0.32
166 0.27
167 0.21
168 0.19
169 0.16
170 0.18
171 0.17
172 0.16
173 0.13
174 0.13
175 0.12
176 0.13
177 0.12
178 0.09
179 0.09
180 0.09
181 0.08
182 0.08
183 0.08
184 0.06
185 0.05
186 0.05
187 0.04
188 0.04
189 0.04
190 0.06
191 0.08
192 0.08
193 0.08
194 0.1
195 0.11
196 0.13
197 0.21
198 0.26
199 0.31
200 0.33
201 0.38
202 0.44
203 0.47
204 0.52
205 0.54
206 0.55
207 0.59
208 0.68
209 0.73
210 0.71
211 0.78
212 0.78
213 0.76
214 0.79
215 0.81
216 0.8
217 0.77