Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0VAZ7

Protein Details
Accession A0A4U0VAZ7    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
91-112LKPLVNKIQKPKRRARNEIAFAHydrophilic
NLS Segment(s)
PositionSequence
12-19KNKSGLKK
82-136KRRSSDKKSLKPLVNKIQKPKRRARNEIAFAPTGRARSKKGSKRGEFGASGRRRT
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MARSARSSALKKNKSGLKKRVFGPVETARNERLNAKLLELAQQPKAPRPEMDVEEESASKATNSEAKAEQSMDVDNDAVVAKRRSSDKKSLKPLVNKIQKPKRRARNEIAFAPTGRARSKKGSKRGEFGASGRRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.73
4 0.72
5 0.73
6 0.72
7 0.74
8 0.68
9 0.59
10 0.57
11 0.55
12 0.52
13 0.49
14 0.49
15 0.42
16 0.42
17 0.42
18 0.36
19 0.3
20 0.29
21 0.26
22 0.24
23 0.23
24 0.21
25 0.25
26 0.26
27 0.26
28 0.23
29 0.25
30 0.24
31 0.27
32 0.3
33 0.27
34 0.24
35 0.26
36 0.29
37 0.28
38 0.33
39 0.29
40 0.26
41 0.26
42 0.25
43 0.21
44 0.16
45 0.13
46 0.07
47 0.07
48 0.06
49 0.09
50 0.09
51 0.12
52 0.13
53 0.13
54 0.14
55 0.15
56 0.14
57 0.11
58 0.11
59 0.08
60 0.08
61 0.07
62 0.06
63 0.06
64 0.05
65 0.05
66 0.07
67 0.08
68 0.08
69 0.1
70 0.16
71 0.22
72 0.28
73 0.38
74 0.46
75 0.54
76 0.63
77 0.69
78 0.71
79 0.72
80 0.75
81 0.75
82 0.75
83 0.71
84 0.73
85 0.75
86 0.75
87 0.76
88 0.77
89 0.78
90 0.78
91 0.81
92 0.8
93 0.81
94 0.8
95 0.78
96 0.72
97 0.64
98 0.54
99 0.5
100 0.42
101 0.34
102 0.32
103 0.3
104 0.29
105 0.37
106 0.47
107 0.53
108 0.61
109 0.68
110 0.7
111 0.73
112 0.75
113 0.71
114 0.64
115 0.59
116 0.59