Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0TP59

Protein Details
Accession A0A4U0TP59    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-86SSVMDDKERRERRERDRIDRPERTESEERRRRERRKEREERHKKEKEKIRKGDRAGVFBasic
NLS Segment(s)
PositionSequence
36-82ERRERRERDRIDRPERTESEERRRRERRKEREERHKKEKEKIRKGDR
360-367KGGGRRAR
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MSRNPFLDASEMPATKSNVSGGLTEDMFSSVMDDKERRERRERDRIDRPERTESEERRRRERRKEREERHKKEKEKIRKGDRAGVFHHDGPFDACNPHRNAKGGRRPAPMQAFPADSANMALGGSGPLRSKLDLDKFHGRGEEGFADYAVTRKPATAIINPTDRIEPVHGEETFGLGTSTFLEGAPAGRAALQRRESEEQGMGDPSGGMMGGGLARKKSLAQRFRGMSASRRGGPNGDLRSPDARYHNTDAINTSPPQYGKAGAASGPSRGVYAKENEVNPFDNDYEGAFDRKGAEIRVAELEKQPLAPRAQSPRMAGLARSVTADSGVVRGSSNEEERGGGGSGSGGGGGFLSRMRSLKGGGRRARVERRDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.28
4 0.23
5 0.19
6 0.2
7 0.2
8 0.18
9 0.19
10 0.19
11 0.18
12 0.17
13 0.15
14 0.14
15 0.13
16 0.12
17 0.11
18 0.12
19 0.16
20 0.17
21 0.21
22 0.32
23 0.4
24 0.44
25 0.51
26 0.6
27 0.66
28 0.76
29 0.81
30 0.8
31 0.83
32 0.87
33 0.87
34 0.86
35 0.82
36 0.81
37 0.73
38 0.72
39 0.7
40 0.68
41 0.69
42 0.69
43 0.68
44 0.69
45 0.77
46 0.78
47 0.8
48 0.83
49 0.83
50 0.86
51 0.93
52 0.93
53 0.94
54 0.95
55 0.93
56 0.93
57 0.92
58 0.88
59 0.86
60 0.86
61 0.86
62 0.86
63 0.87
64 0.86
65 0.85
66 0.83
67 0.82
68 0.77
69 0.7
70 0.62
71 0.59
72 0.52
73 0.46
74 0.43
75 0.33
76 0.28
77 0.26
78 0.24
79 0.19
80 0.18
81 0.17
82 0.21
83 0.26
84 0.3
85 0.3
86 0.33
87 0.39
88 0.46
89 0.55
90 0.58
91 0.61
92 0.62
93 0.61
94 0.65
95 0.65
96 0.56
97 0.49
98 0.42
99 0.36
100 0.31
101 0.3
102 0.23
103 0.16
104 0.14
105 0.11
106 0.08
107 0.06
108 0.05
109 0.04
110 0.04
111 0.05
112 0.06
113 0.06
114 0.07
115 0.08
116 0.09
117 0.1
118 0.15
119 0.22
120 0.24
121 0.3
122 0.37
123 0.38
124 0.38
125 0.38
126 0.33
127 0.26
128 0.26
129 0.22
130 0.14
131 0.13
132 0.11
133 0.11
134 0.1
135 0.11
136 0.08
137 0.08
138 0.07
139 0.07
140 0.08
141 0.1
142 0.13
143 0.16
144 0.2
145 0.22
146 0.25
147 0.26
148 0.26
149 0.24
150 0.21
151 0.18
152 0.15
153 0.13
154 0.12
155 0.15
156 0.14
157 0.14
158 0.14
159 0.13
160 0.12
161 0.11
162 0.08
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.04
174 0.04
175 0.05
176 0.07
177 0.09
178 0.14
179 0.17
180 0.18
181 0.22
182 0.25
183 0.25
184 0.25
185 0.24
186 0.2
187 0.17
188 0.17
189 0.12
190 0.09
191 0.08
192 0.06
193 0.05
194 0.04
195 0.03
196 0.02
197 0.02
198 0.03
199 0.04
200 0.05
201 0.05
202 0.06
203 0.06
204 0.08
205 0.15
206 0.24
207 0.3
208 0.34
209 0.41
210 0.42
211 0.44
212 0.47
213 0.41
214 0.37
215 0.37
216 0.37
217 0.33
218 0.32
219 0.31
220 0.28
221 0.29
222 0.31
223 0.28
224 0.26
225 0.25
226 0.26
227 0.29
228 0.29
229 0.3
230 0.28
231 0.27
232 0.3
233 0.34
234 0.35
235 0.33
236 0.32
237 0.3
238 0.28
239 0.28
240 0.23
241 0.21
242 0.19
243 0.19
244 0.2
245 0.19
246 0.17
247 0.15
248 0.16
249 0.14
250 0.12
251 0.15
252 0.13
253 0.13
254 0.13
255 0.12
256 0.11
257 0.11
258 0.12
259 0.13
260 0.16
261 0.2
262 0.24
263 0.26
264 0.27
265 0.29
266 0.3
267 0.28
268 0.27
269 0.22
270 0.18
271 0.17
272 0.15
273 0.15
274 0.14
275 0.14
276 0.12
277 0.12
278 0.13
279 0.15
280 0.16
281 0.13
282 0.16
283 0.15
284 0.17
285 0.22
286 0.22
287 0.22
288 0.23
289 0.25
290 0.22
291 0.23
292 0.23
293 0.22
294 0.24
295 0.24
296 0.28
297 0.34
298 0.4
299 0.42
300 0.42
301 0.41
302 0.43
303 0.41
304 0.35
305 0.32
306 0.28
307 0.25
308 0.24
309 0.2
310 0.16
311 0.16
312 0.16
313 0.11
314 0.09
315 0.09
316 0.08
317 0.08
318 0.09
319 0.12
320 0.16
321 0.18
322 0.19
323 0.19
324 0.19
325 0.2
326 0.21
327 0.18
328 0.13
329 0.11
330 0.09
331 0.09
332 0.08
333 0.07
334 0.05
335 0.04
336 0.04
337 0.04
338 0.05
339 0.05
340 0.08
341 0.11
342 0.12
343 0.14
344 0.16
345 0.19
346 0.26
347 0.35
348 0.43
349 0.48
350 0.55
351 0.6
352 0.68
353 0.75