Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WG15

Protein Details
Accession A0A4U0WG15    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-54GDRTDPEKVYGRRKNRKARFIPNKGEWKSBasic
152-171DAPPEEPKKRGKKGQDQGMEBasic
NLS Segment(s)
PositionSequence
37-44RRKNRKAR
159-163KKRGK
Subcellular Location(s) cyto 9.5, nucl 9, cyto_mito 8.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences SLKQKPKKGDPRLIVTLSELETAVLGDRTDPEKVYGRRKNRKARFIPNKGEWKSIDMEDRDNVNDDTADSYTDDDGSAEDTVAGVPVKDRVRPPQTESEVNFSVGGERGWAEKIEETPEMLTKRREGQKRAEEKEMVKCAARRAVAFGLLVDAPPEEPKKRGKKGQDQGMEEAAPQKMTRKCEALVHGQVVEPSFAKGDWAIRWRED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.54
3 0.46
4 0.37
5 0.3
6 0.22
7 0.14
8 0.12
9 0.12
10 0.1
11 0.08
12 0.07
13 0.06
14 0.09
15 0.11
16 0.13
17 0.13
18 0.16
19 0.24
20 0.3
21 0.4
22 0.46
23 0.55
24 0.64
25 0.74
26 0.82
27 0.82
28 0.88
29 0.87
30 0.89
31 0.89
32 0.88
33 0.87
34 0.85
35 0.85
36 0.77
37 0.72
38 0.62
39 0.54
40 0.47
41 0.4
42 0.37
43 0.28
44 0.28
45 0.25
46 0.26
47 0.23
48 0.23
49 0.21
50 0.16
51 0.14
52 0.12
53 0.12
54 0.1
55 0.1
56 0.08
57 0.09
58 0.08
59 0.08
60 0.08
61 0.06
62 0.06
63 0.07
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.03
72 0.04
73 0.09
74 0.1
75 0.12
76 0.14
77 0.21
78 0.27
79 0.29
80 0.34
81 0.37
82 0.4
83 0.42
84 0.42
85 0.4
86 0.35
87 0.34
88 0.29
89 0.2
90 0.17
91 0.13
92 0.11
93 0.06
94 0.05
95 0.05
96 0.06
97 0.06
98 0.06
99 0.07
100 0.08
101 0.1
102 0.1
103 0.09
104 0.09
105 0.13
106 0.14
107 0.15
108 0.15
109 0.15
110 0.22
111 0.3
112 0.35
113 0.36
114 0.44
115 0.52
116 0.61
117 0.63
118 0.61
119 0.56
120 0.53
121 0.57
122 0.51
123 0.42
124 0.35
125 0.32
126 0.3
127 0.32
128 0.3
129 0.22
130 0.23
131 0.22
132 0.21
133 0.2
134 0.16
135 0.14
136 0.12
137 0.12
138 0.08
139 0.07
140 0.06
141 0.09
142 0.13
143 0.13
144 0.16
145 0.26
146 0.35
147 0.43
148 0.51
149 0.58
150 0.66
151 0.74
152 0.81
153 0.8
154 0.74
155 0.7
156 0.64
157 0.55
158 0.44
159 0.38
160 0.28
161 0.21
162 0.17
163 0.21
164 0.22
165 0.27
166 0.31
167 0.31
168 0.32
169 0.37
170 0.42
171 0.43
172 0.44
173 0.42
174 0.38
175 0.35
176 0.34
177 0.29
178 0.26
179 0.18
180 0.14
181 0.12
182 0.11
183 0.12
184 0.12
185 0.15
186 0.19
187 0.24