Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0XAE4

Protein Details
Accession A0A4U0XAE4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-40IRSSGRTRLYGKKKTKKKTKKKRSEEHGMNEKABasic
NLS Segment(s)
PositionSequence
14-31TRLYGKKKTKKKTKKKRS
Subcellular Location(s) mito 19, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MAAVSVPIRSSGRTRLYGKKKTKKKTKKKRSEEHGMNEKATMPPSQQQVRSERAPLLQRVPVEEGQRVHYPNQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.46
3 0.55
4 0.64
5 0.71
6 0.74
7 0.78
8 0.82
9 0.88
10 0.89
11 0.91
12 0.92
13 0.93
14 0.94
15 0.95
16 0.94
17 0.92
18 0.91
19 0.88
20 0.85
21 0.83
22 0.74
23 0.63
24 0.53
25 0.45
26 0.35
27 0.28
28 0.19
29 0.11
30 0.13
31 0.19
32 0.23
33 0.25
34 0.29
35 0.32
36 0.36
37 0.37
38 0.36
39 0.32
40 0.33
41 0.34
42 0.33
43 0.32
44 0.31
45 0.29
46 0.3
47 0.33
48 0.32
49 0.3
50 0.31
51 0.29
52 0.31
53 0.35
54 0.34