Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L6D5

Protein Details
Accession E2L6D5    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
170-198DDPDIKAVRNRRRMKKKQEKALQRGEKKGBasic
NLS Segment(s)
PositionSequence
177-202VRNRRRMKKKQEKALQRGEKKGESSK
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
KEGG mpr:MPER_01373  -  
Amino Acid Sequences MYFGFQVEEQQRVLVLDISENKFNSTSQKIKLIERRAKIQRAVARFRTLQRTYTPAALAESAVTQDSTPASIELISLRLPSSLTESARQHPDLKKWVDMEAQYRRAQLSASLYDIRTLLFIRTRLYGKRSLNILGQHASTKARDVLAKNERDPSKIGWRWLKDKDVVSFDDPDIKAVRNRRRMKKKQEKALQRGEKKGESSKAPLLVAGESRRKLSWIWTGVDIEDGCEALQEATRIEWCKAWARRQRWAEELQLLEEEKRRTIDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.15
4 0.22
5 0.25
6 0.28
7 0.28
8 0.28
9 0.27
10 0.27
11 0.29
12 0.29
13 0.32
14 0.32
15 0.4
16 0.42
17 0.49
18 0.57
19 0.61
20 0.62
21 0.61
22 0.67
23 0.67
24 0.71
25 0.66
26 0.66
27 0.62
28 0.62
29 0.66
30 0.61
31 0.59
32 0.56
33 0.58
34 0.59
35 0.54
36 0.49
37 0.44
38 0.44
39 0.4
40 0.39
41 0.34
42 0.25
43 0.24
44 0.21
45 0.18
46 0.13
47 0.11
48 0.09
49 0.08
50 0.08
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.07
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.12
69 0.15
70 0.16
71 0.21
72 0.23
73 0.27
74 0.31
75 0.33
76 0.33
77 0.33
78 0.37
79 0.4
80 0.4
81 0.39
82 0.36
83 0.36
84 0.33
85 0.31
86 0.33
87 0.32
88 0.34
89 0.32
90 0.32
91 0.3
92 0.27
93 0.25
94 0.2
95 0.17
96 0.13
97 0.15
98 0.16
99 0.16
100 0.16
101 0.16
102 0.14
103 0.1
104 0.1
105 0.08
106 0.09
107 0.1
108 0.1
109 0.13
110 0.15
111 0.16
112 0.19
113 0.25
114 0.24
115 0.27
116 0.27
117 0.27
118 0.27
119 0.27
120 0.26
121 0.19
122 0.19
123 0.16
124 0.15
125 0.14
126 0.12
127 0.11
128 0.1
129 0.1
130 0.12
131 0.13
132 0.21
133 0.27
134 0.3
135 0.3
136 0.36
137 0.36
138 0.35
139 0.35
140 0.3
141 0.33
142 0.33
143 0.37
144 0.37
145 0.4
146 0.44
147 0.46
148 0.46
149 0.4
150 0.4
151 0.38
152 0.35
153 0.34
154 0.3
155 0.28
156 0.25
157 0.27
158 0.24
159 0.22
160 0.21
161 0.19
162 0.21
163 0.28
164 0.37
165 0.4
166 0.5
167 0.59
168 0.69
169 0.78
170 0.86
171 0.89
172 0.89
173 0.9
174 0.9
175 0.9
176 0.88
177 0.88
178 0.87
179 0.82
180 0.79
181 0.74
182 0.67
183 0.6
184 0.57
185 0.51
186 0.44
187 0.43
188 0.4
189 0.38
190 0.35
191 0.31
192 0.26
193 0.23
194 0.23
195 0.23
196 0.26
197 0.24
198 0.26
199 0.26
200 0.26
201 0.25
202 0.27
203 0.3
204 0.28
205 0.29
206 0.3
207 0.31
208 0.3
209 0.32
210 0.27
211 0.19
212 0.15
213 0.12
214 0.09
215 0.08
216 0.09
217 0.06
218 0.07
219 0.07
220 0.07
221 0.09
222 0.13
223 0.15
224 0.16
225 0.18
226 0.19
227 0.29
228 0.35
229 0.44
230 0.5
231 0.53
232 0.62
233 0.68
234 0.71
235 0.67
236 0.65
237 0.62
238 0.58
239 0.54
240 0.46
241 0.41
242 0.36
243 0.33
244 0.34
245 0.3
246 0.26