Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V5NHJ9

Protein Details
Accession A0A4V5NHJ9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAAGKKQKKKWSKGKVKDKANHAVIHydrophilic
NLS Segment(s)
PositionSequence
7-22GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAAGKKQKKKWSKGKVKDKANHAVILDKNTAEKLAKDVQSYRLITVAVLVDRLKINGSLARKALADLEEKGTIKKVVAHNSGNIYTVGGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.91
6 0.92
7 0.88
8 0.85
9 0.83
10 0.74
11 0.66
12 0.55
13 0.52
14 0.43
15 0.39
16 0.33
17 0.24
18 0.21
19 0.18
20 0.19
21 0.14
22 0.12
23 0.12
24 0.17
25 0.18
26 0.19
27 0.21
28 0.24
29 0.28
30 0.29
31 0.25
32 0.2
33 0.18
34 0.16
35 0.16
36 0.12
37 0.06
38 0.07
39 0.06
40 0.07
41 0.07
42 0.08
43 0.07
44 0.07
45 0.08
46 0.11
47 0.13
48 0.15
49 0.15
50 0.16
51 0.16
52 0.16
53 0.17
54 0.15
55 0.15
56 0.14
57 0.16
58 0.18
59 0.19
60 0.19
61 0.19
62 0.18
63 0.17
64 0.21
65 0.24
66 0.29
67 0.35
68 0.37
69 0.38
70 0.43
71 0.43
72 0.38
73 0.33
74 0.25