Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0XM55

Protein Details
Accession A0A4U0XM55    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
83-106SKRSGIVRKWLEKRREKKGCGDRGBasic
NLS Segment(s)
PositionSequence
88-100IVRKWLEKRREKK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, cyto 3.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSGPTKRVEDMTPEERLRSLQEYAEGKKYVRPGEDGTLPRGPGAMQALVFGGPMRRAPEYNTPLPPPSYGTVAGQQLPQGSSSKRSGIVRKWLEKRREKKGCGDRGIAEGEKKDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.35
4 0.31
5 0.27
6 0.24
7 0.18
8 0.23
9 0.27
10 0.29
11 0.34
12 0.31
13 0.28
14 0.3
15 0.34
16 0.31
17 0.28
18 0.28
19 0.25
20 0.28
21 0.35
22 0.33
23 0.33
24 0.32
25 0.3
26 0.27
27 0.24
28 0.19
29 0.14
30 0.14
31 0.1
32 0.08
33 0.08
34 0.08
35 0.08
36 0.08
37 0.06
38 0.05
39 0.05
40 0.06
41 0.07
42 0.08
43 0.08
44 0.12
45 0.2
46 0.25
47 0.28
48 0.3
49 0.3
50 0.3
51 0.31
52 0.28
53 0.22
54 0.18
55 0.16
56 0.15
57 0.14
58 0.16
59 0.17
60 0.17
61 0.15
62 0.14
63 0.13
64 0.13
65 0.13
66 0.12
67 0.12
68 0.15
69 0.17
70 0.19
71 0.22
72 0.26
73 0.31
74 0.35
75 0.44
76 0.48
77 0.55
78 0.63
79 0.68
80 0.73
81 0.77
82 0.8
83 0.8
84 0.82
85 0.77
86 0.79
87 0.8
88 0.8
89 0.76
90 0.72
91 0.63
92 0.56
93 0.58
94 0.5
95 0.43