Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WCV1

Protein Details
Accession A0A4U0WCV1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
111-136CLLCCIPRWRSRRERRKRAEEELAKRHydrophilic
308-328MGSMRGRKRGKPDGRGNLLNLHydrophilic
NLS Segment(s)
PositionSequence
119-131WRSRRERRKRAEE
314-318RKRGK
Subcellular Location(s) cyto 7.5, cyto_nucl 6.5, mito 6, plas 6, nucl 4.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences PTSLTTPHWGTTQQDMLYYPHTPTVWSKKGTTHVAMATQKPAHDEQKKYRVLNAMGPPSCWDRHTCCAECWTSARSGGWLGSLRHPFNFHKALAYFALLGLLGLLASLLTCLLCCIPRWRSRRERRKRAEEELAKREKITVVDPAPGVETVVVTSTPGQAIDPATAAAATGAAVVVANQGTTTGADPNDGRGTMARRAEEGRGHVQFAPPPANTVVTSTQPADPATGTGEKVTTTVTPAGAPAGAPADKKKTEQEKSANAAQQKAEVAGTPPVPAATAPVVTEQVAPVPVHDGVYDWPPTTGSQYADMGSMRGRKRGKPDGRGNLLNLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.29
4 0.3
5 0.28
6 0.23
7 0.21
8 0.21
9 0.21
10 0.27
11 0.35
12 0.38
13 0.4
14 0.41
15 0.43
16 0.5
17 0.54
18 0.49
19 0.44
20 0.39
21 0.43
22 0.46
23 0.42
24 0.41
25 0.37
26 0.35
27 0.34
28 0.37
29 0.39
30 0.42
31 0.48
32 0.51
33 0.59
34 0.66
35 0.63
36 0.63
37 0.61
38 0.55
39 0.56
40 0.53
41 0.52
42 0.46
43 0.45
44 0.44
45 0.4
46 0.39
47 0.32
48 0.29
49 0.26
50 0.33
51 0.41
52 0.4
53 0.38
54 0.42
55 0.42
56 0.4
57 0.37
58 0.32
59 0.25
60 0.24
61 0.23
62 0.18
63 0.17
64 0.15
65 0.16
66 0.17
67 0.17
68 0.23
69 0.28
70 0.29
71 0.29
72 0.33
73 0.32
74 0.35
75 0.37
76 0.3
77 0.29
78 0.28
79 0.29
80 0.26
81 0.25
82 0.18
83 0.13
84 0.13
85 0.08
86 0.08
87 0.05
88 0.04
89 0.03
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.03
99 0.04
100 0.05
101 0.06
102 0.12
103 0.18
104 0.27
105 0.32
106 0.41
107 0.51
108 0.62
109 0.72
110 0.78
111 0.83
112 0.84
113 0.91
114 0.89
115 0.85
116 0.85
117 0.83
118 0.8
119 0.78
120 0.73
121 0.62
122 0.55
123 0.48
124 0.39
125 0.31
126 0.24
127 0.2
128 0.16
129 0.18
130 0.18
131 0.17
132 0.16
133 0.15
134 0.13
135 0.07
136 0.06
137 0.04
138 0.05
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.06
149 0.05
150 0.05
151 0.05
152 0.05
153 0.04
154 0.03
155 0.03
156 0.03
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.03
163 0.03
164 0.02
165 0.02
166 0.03
167 0.03
168 0.04
169 0.04
170 0.05
171 0.05
172 0.07
173 0.07
174 0.09
175 0.1
176 0.1
177 0.09
178 0.1
179 0.13
180 0.16
181 0.18
182 0.17
183 0.17
184 0.19
185 0.21
186 0.21
187 0.22
188 0.23
189 0.22
190 0.23
191 0.23
192 0.22
193 0.21
194 0.22
195 0.22
196 0.16
197 0.17
198 0.16
199 0.17
200 0.16
201 0.17
202 0.17
203 0.15
204 0.16
205 0.16
206 0.16
207 0.16
208 0.16
209 0.14
210 0.12
211 0.11
212 0.12
213 0.12
214 0.11
215 0.1
216 0.1
217 0.1
218 0.1
219 0.1
220 0.08
221 0.09
222 0.1
223 0.1
224 0.09
225 0.1
226 0.1
227 0.09
228 0.08
229 0.06
230 0.08
231 0.09
232 0.09
233 0.12
234 0.18
235 0.19
236 0.21
237 0.29
238 0.37
239 0.41
240 0.48
241 0.53
242 0.54
243 0.58
244 0.63
245 0.59
246 0.51
247 0.5
248 0.42
249 0.36
250 0.3
251 0.25
252 0.19
253 0.15
254 0.15
255 0.15
256 0.15
257 0.13
258 0.13
259 0.12
260 0.12
261 0.11
262 0.11
263 0.1
264 0.1
265 0.1
266 0.11
267 0.12
268 0.13
269 0.13
270 0.11
271 0.11
272 0.12
273 0.12
274 0.11
275 0.13
276 0.12
277 0.12
278 0.12
279 0.12
280 0.11
281 0.15
282 0.17
283 0.14
284 0.14
285 0.15
286 0.16
287 0.19
288 0.2
289 0.17
290 0.19
291 0.2
292 0.2
293 0.21
294 0.2
295 0.17
296 0.19
297 0.25
298 0.24
299 0.31
300 0.35
301 0.39
302 0.48
303 0.58
304 0.64
305 0.67
306 0.75
307 0.78
308 0.82
309 0.8
310 0.73