Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0XC35

Protein Details
Accession A0A4U0XC35    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-54DGAWGSRRRPRRRGHGHRGGABasic
NLS Segment(s)
PositionSequence
39-54SRRRPRRRGHGHRGGA
Subcellular Location(s) cyto 9, mito 7, nucl 6, plas 3
Family & Domain DBs
Amino Acid Sequences MGCFPSKPDDLSGQPSAYHPISYRARPMETSALDGAWGSRRRPRRRGHGHRGGAGGAGGIGGIMVVVVAEEAEVEVEGDVESGLRRWYWLLGSFFRGVCSGYMLAGLAEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.3
4 0.26
5 0.24
6 0.18
7 0.23
8 0.27
9 0.29
10 0.34
11 0.33
12 0.34
13 0.33
14 0.36
15 0.35
16 0.3
17 0.31
18 0.25
19 0.21
20 0.19
21 0.18
22 0.15
23 0.16
24 0.17
25 0.16
26 0.22
27 0.32
28 0.4
29 0.49
30 0.55
31 0.6
32 0.69
33 0.78
34 0.82
35 0.83
36 0.79
37 0.73
38 0.66
39 0.55
40 0.43
41 0.32
42 0.21
43 0.11
44 0.07
45 0.03
46 0.02
47 0.02
48 0.01
49 0.01
50 0.01
51 0.01
52 0.01
53 0.01
54 0.01
55 0.01
56 0.01
57 0.01
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.05
71 0.05
72 0.06
73 0.06
74 0.08
75 0.1
76 0.16
77 0.2
78 0.21
79 0.26
80 0.28
81 0.27
82 0.27
83 0.25
84 0.2
85 0.16
86 0.17
87 0.13
88 0.11
89 0.11
90 0.1