Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0Y0T3

Protein Details
Accession A0A4U0Y0T3    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
80-112ATKLRSGDKRGKPRANKIQKSKRRARNEIAFAPHydrophilic
NLS Segment(s)
PositionSequence
11-19KKNKSGLRK
84-124RSGDKRGKPRANKIQKSKRRARNEIAFAPTGRARSKKGSKR
Subcellular Location(s) nucl 22, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MARSARSSAIKKNKSGLRKKVFGPVETARNERLNAKLLELAQQPKAPRPEMDVEEESASKTAEPEAKAEQSMDVDGDSVATKLRSGDKRGKPRANKIQKSKRRARNEIAFAPTGRARSKKGSKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.73
4 0.71
5 0.7
6 0.69
7 0.7
8 0.67
9 0.58
10 0.54
11 0.49
12 0.47
13 0.45
14 0.45
15 0.39
16 0.37
17 0.37
18 0.32
19 0.3
20 0.28
21 0.25
22 0.24
23 0.23
24 0.21
25 0.24
26 0.25
27 0.25
28 0.22
29 0.24
30 0.23
31 0.26
32 0.29
33 0.26
34 0.23
35 0.25
36 0.27
37 0.27
38 0.31
39 0.27
40 0.25
41 0.24
42 0.24
43 0.2
44 0.15
45 0.13
46 0.07
47 0.06
48 0.07
49 0.09
50 0.09
51 0.11
52 0.13
53 0.13
54 0.14
55 0.14
56 0.12
57 0.1
58 0.1
59 0.08
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.14
71 0.17
72 0.23
73 0.33
74 0.42
75 0.53
76 0.63
77 0.71
78 0.71
79 0.78
80 0.83
81 0.84
82 0.85
83 0.85
84 0.87
85 0.87
86 0.9
87 0.9
88 0.89
89 0.88
90 0.87
91 0.85
92 0.84
93 0.83
94 0.79
95 0.74
96 0.66
97 0.56
98 0.52
99 0.45
100 0.39
101 0.36
102 0.33
103 0.33
104 0.4