Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0X7S2

Protein Details
Accession A0A4U0X7S2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
256-289MRQRFHERPGLKRKRLKGERWRRRFKENFKGVVGBasic
NLS Segment(s)
PositionSequence
260-281FHERPGLKRKRLKGERWRRRFK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences SGSNIAPSPTKSASAWRMQAKKTTTPIHILPLSRGTMDLFRVGEALLRSPQPFLPFLAPSAARPQSRRAIDALSRHCRPSRHALSTSSTNHVEDHRDPPSSERQPRSSDISSLLDSALDGTKGTPSAPATRTSHFKSNTAQAGAPPSRLTGQDLPQKGDSVSELLDSMRSPRTLRSQQPSSRRASDSSFSEISAILDGPGSYSPSKTNSPFSRNNLSPQPTPLLIEKFLPMKLNASVGRTVTIDNCNKNSVKRDFMRQRFHERPGLKRKRLKGERWRRRFKENFKGVVGLVKSMTAQGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.49
4 0.54
5 0.54
6 0.61
7 0.59
8 0.59
9 0.6
10 0.59
11 0.53
12 0.52
13 0.51
14 0.51
15 0.49
16 0.43
17 0.38
18 0.36
19 0.34
20 0.28
21 0.27
22 0.22
23 0.2
24 0.2
25 0.2
26 0.16
27 0.15
28 0.15
29 0.14
30 0.15
31 0.13
32 0.14
33 0.14
34 0.16
35 0.16
36 0.18
37 0.2
38 0.2
39 0.2
40 0.2
41 0.21
42 0.2
43 0.2
44 0.23
45 0.21
46 0.2
47 0.26
48 0.29
49 0.28
50 0.3
51 0.34
52 0.38
53 0.4
54 0.4
55 0.35
56 0.35
57 0.36
58 0.43
59 0.46
60 0.45
61 0.45
62 0.47
63 0.48
64 0.45
65 0.45
66 0.48
67 0.47
68 0.47
69 0.48
70 0.48
71 0.49
72 0.55
73 0.52
74 0.46
75 0.39
76 0.32
77 0.3
78 0.28
79 0.28
80 0.24
81 0.26
82 0.25
83 0.25
84 0.25
85 0.27
86 0.35
87 0.39
88 0.44
89 0.44
90 0.46
91 0.48
92 0.51
93 0.54
94 0.46
95 0.38
96 0.34
97 0.31
98 0.27
99 0.24
100 0.21
101 0.13
102 0.12
103 0.11
104 0.08
105 0.06
106 0.05
107 0.05
108 0.05
109 0.06
110 0.06
111 0.07
112 0.08
113 0.12
114 0.14
115 0.18
116 0.2
117 0.23
118 0.27
119 0.29
120 0.35
121 0.32
122 0.32
123 0.3
124 0.33
125 0.33
126 0.3
127 0.27
128 0.2
129 0.25
130 0.24
131 0.22
132 0.16
133 0.14
134 0.14
135 0.14
136 0.17
137 0.13
138 0.18
139 0.23
140 0.24
141 0.26
142 0.25
143 0.25
144 0.22
145 0.19
146 0.15
147 0.1
148 0.09
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.08
155 0.08
156 0.09
157 0.1
158 0.12
159 0.2
160 0.27
161 0.33
162 0.39
163 0.45
164 0.51
165 0.59
166 0.62
167 0.59
168 0.57
169 0.53
170 0.47
171 0.42
172 0.39
173 0.33
174 0.33
175 0.28
176 0.24
177 0.22
178 0.2
179 0.17
180 0.14
181 0.11
182 0.06
183 0.05
184 0.05
185 0.05
186 0.06
187 0.08
188 0.07
189 0.08
190 0.1
191 0.13
192 0.18
193 0.19
194 0.27
195 0.31
196 0.37
197 0.43
198 0.48
199 0.53
200 0.51
201 0.54
202 0.53
203 0.52
204 0.47
205 0.43
206 0.41
207 0.32
208 0.33
209 0.31
210 0.26
211 0.22
212 0.22
213 0.21
214 0.2
215 0.21
216 0.21
217 0.17
218 0.17
219 0.17
220 0.21
221 0.2
222 0.21
223 0.22
224 0.2
225 0.21
226 0.19
227 0.19
228 0.17
229 0.24
230 0.27
231 0.29
232 0.31
233 0.34
234 0.35
235 0.39
236 0.44
237 0.42
238 0.45
239 0.44
240 0.53
241 0.59
242 0.67
243 0.73
244 0.71
245 0.76
246 0.74
247 0.75
248 0.73
249 0.68
250 0.69
251 0.7
252 0.74
253 0.74
254 0.76
255 0.79
256 0.82
257 0.87
258 0.87
259 0.87
260 0.88
261 0.89
262 0.91
263 0.94
264 0.88
265 0.89
266 0.88
267 0.87
268 0.87
269 0.86
270 0.81
271 0.73
272 0.7
273 0.6
274 0.56
275 0.47
276 0.38
277 0.28
278 0.22
279 0.19