Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WYX2

Protein Details
Accession A0A4U0WYX2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
142-167KAAMERKAVAKPRKKAKPIKLAFDEEHydrophilic
NLS Segment(s)
PositionSequence
146-161ERKAVAKPRKKAKPIK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSGKIKAKDLSYDTALPPFLQRLHDQKAGRGDSDRHERPLARPTRAKDPNDDDGPTVVDESGETVSKEEYEQLTKADAETADATAGGNVSGEAKDDPAISMSGAMPAEDGKKGGVMATSGLVTKKRKAAKVVGDEDGDVATKAAMERKAVAKPRKKAKPIKLAFDEEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.27
4 0.24
5 0.22
6 0.19
7 0.19
8 0.23
9 0.27
10 0.33
11 0.4
12 0.39
13 0.41
14 0.47
15 0.46
16 0.43
17 0.4
18 0.36
19 0.36
20 0.45
21 0.44
22 0.39
23 0.4
24 0.41
25 0.4
26 0.47
27 0.46
28 0.44
29 0.47
30 0.47
31 0.54
32 0.6
33 0.59
34 0.56
35 0.56
36 0.57
37 0.53
38 0.5
39 0.4
40 0.33
41 0.32
42 0.25
43 0.18
44 0.11
45 0.08
46 0.06
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.1
58 0.1
59 0.1
60 0.11
61 0.11
62 0.11
63 0.1
64 0.08
65 0.08
66 0.08
67 0.07
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.05
87 0.06
88 0.06
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.08
95 0.07
96 0.07
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.05
103 0.06
104 0.06
105 0.06
106 0.07
107 0.08
108 0.13
109 0.15
110 0.18
111 0.25
112 0.3
113 0.34
114 0.38
115 0.45
116 0.49
117 0.56
118 0.57
119 0.53
120 0.48
121 0.44
122 0.39
123 0.32
124 0.23
125 0.14
126 0.09
127 0.06
128 0.06
129 0.06
130 0.11
131 0.12
132 0.13
133 0.16
134 0.2
135 0.28
136 0.37
137 0.46
138 0.51
139 0.59
140 0.68
141 0.75
142 0.81
143 0.84
144 0.86
145 0.87
146 0.85
147 0.86
148 0.83