Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0WPW1

Protein Details
Accession A0A4U0WPW1    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-83ECNQYSPTKGRPRLKKAIANAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 6, nucl 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004839  Aminotransferase_I/II  
IPR015424  PyrdxlP-dep_Trfase  
IPR015421  PyrdxlP-dep_Trfase_major  
IPR015422  PyrdxlP-dep_Trfase_small  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0030170  F:pyridoxal phosphate binding  
GO:0009058  P:biosynthetic process  
Pfam View protein in Pfam  
PF00155  Aminotran_1_2  
Amino Acid Sequences MRQDPFKPAARVAGQRQDVWTIVNEAATASPVQPIVNMGQGFFGYNPPEFVLDAARDALSKVECNQYSPTKGRPRLKKAIANA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.44
4 0.39
5 0.34
6 0.29
7 0.23
8 0.17
9 0.14
10 0.13
11 0.11
12 0.1
13 0.09
14 0.09
15 0.08
16 0.05
17 0.06
18 0.06
19 0.06
20 0.06
21 0.07
22 0.07
23 0.1
24 0.1
25 0.09
26 0.09
27 0.09
28 0.1
29 0.09
30 0.09
31 0.07
32 0.07
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.09
39 0.08
40 0.08
41 0.09
42 0.08
43 0.08
44 0.08
45 0.09
46 0.09
47 0.09
48 0.11
49 0.18
50 0.18
51 0.21
52 0.26
53 0.3
54 0.35
55 0.37
56 0.45
57 0.47
58 0.56
59 0.63
60 0.68
61 0.73
62 0.77
63 0.82