Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0VPP1

Protein Details
Accession A0A4U0VPP1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-34EEALVGSPRKRKKKPIVVYDIVHydrophilic
NLS Segment(s)
PositionSequence
20-26PRKRKKK
Subcellular Location(s) nucl 7.5cyto_nucl 7.5, cyto 6.5, plas 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007135  Atg3/Atg10  
Gene Ontology GO:0016020  C:membrane  
GO:0019787  F:ubiquitin-like protein transferase activity  
GO:0006914  P:autophagy  
Pfam View protein in Pfam  
PF03987  Autophagy_act_C  
Amino Acid Sequences MESAGIAEEDDDEEALVGSPRKRKKKPIVVYDIVYSPSYRVPVLYLTLKHAPGANIYELLVPVSHQPQMQNTGLSGSLSLTDHPVTGLPVYFVHPCRTAEAMAAVRGVSSEGPIEYLMLWFGLVGSSVGLAVPVALAEALRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.1
5 0.14
6 0.22
7 0.31
8 0.41
9 0.48
10 0.58
11 0.68
12 0.76
13 0.82
14 0.85
15 0.85
16 0.8
17 0.75
18 0.67
19 0.57
20 0.48
21 0.39
22 0.28
23 0.19
24 0.16
25 0.15
26 0.12
27 0.11
28 0.1
29 0.1
30 0.13
31 0.16
32 0.15
33 0.19
34 0.22
35 0.22
36 0.21
37 0.21
38 0.18
39 0.16
40 0.18
41 0.14
42 0.11
43 0.11
44 0.11
45 0.09
46 0.09
47 0.07
48 0.05
49 0.06
50 0.07
51 0.08
52 0.08
53 0.09
54 0.1
55 0.15
56 0.15
57 0.14
58 0.13
59 0.12
60 0.12
61 0.11
62 0.1
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.08
78 0.11
79 0.12
80 0.15
81 0.17
82 0.17
83 0.19
84 0.2
85 0.18
86 0.16
87 0.18
88 0.17
89 0.15
90 0.15
91 0.12
92 0.1
93 0.1
94 0.1
95 0.06
96 0.05
97 0.06
98 0.05
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03