Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WXB9

Protein Details
Accession A0A4U0WXB9    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
141-167TKAASEKKAVAKPRKKAKPIKLAFDEEHydrophilic
NLS Segment(s)
PositionSequence
145-161SEKKAVAKPRKKAKPIK
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSGKIKAKDLRYDTALPPFLQRLHDQKAGRGDTDRHERPLARPTRAKDPNDDDGPTVVDESGETVSKEEYEKLTAAGAETADAIAHGNVSGEAKDDPAISVSGAVPAEDGKKGGVMATSGLVTKKRKAAKVVGDEDGDVATKAASEKKAVAKPRKKAKPIKLAFDEEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.4
4 0.38
5 0.35
6 0.32
7 0.3
8 0.32
9 0.31
10 0.35
11 0.41
12 0.39
13 0.41
14 0.47
15 0.46
16 0.43
17 0.4
18 0.36
19 0.36
20 0.45
21 0.44
22 0.39
23 0.4
24 0.41
25 0.4
26 0.47
27 0.46
28 0.44
29 0.47
30 0.47
31 0.54
32 0.6
33 0.59
34 0.56
35 0.56
36 0.57
37 0.53
38 0.5
39 0.4
40 0.33
41 0.32
42 0.25
43 0.18
44 0.11
45 0.08
46 0.06
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.08
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.08
63 0.07
64 0.06
65 0.05
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.06
88 0.06
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.08
95 0.07
96 0.07
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.05
103 0.06
104 0.06
105 0.06
106 0.07
107 0.08
108 0.13
109 0.15
110 0.18
111 0.25
112 0.3
113 0.34
114 0.38
115 0.45
116 0.49
117 0.56
118 0.57
119 0.53
120 0.48
121 0.44
122 0.39
123 0.32
124 0.23
125 0.14
126 0.09
127 0.06
128 0.06
129 0.07
130 0.11
131 0.12
132 0.13
133 0.18
134 0.26
135 0.33
136 0.42
137 0.52
138 0.56
139 0.65
140 0.74
141 0.8
142 0.82
143 0.87
144 0.87
145 0.88
146 0.86
147 0.86
148 0.83