Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0XMK5

Protein Details
Accession A0A4U0XMK5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
29-56NVPKTRRTYCKGKDCKKHTNHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, nucl 12.5, cyto 9.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MRLGLDYTEAASIQFSLERSLTVDELQVNVPKTRRTYCKGKDCKKHTNHKVTQYKAGKASQYAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTQCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.1
4 0.1
5 0.1
6 0.12
7 0.14
8 0.14
9 0.12
10 0.14
11 0.12
12 0.13
13 0.14
14 0.16
15 0.16
16 0.18
17 0.2
18 0.22
19 0.26
20 0.31
21 0.36
22 0.39
23 0.47
24 0.54
25 0.63
26 0.7
27 0.75
28 0.79
29 0.81
30 0.85
31 0.83
32 0.85
33 0.84
34 0.85
35 0.82
36 0.82
37 0.82
38 0.75
39 0.75
40 0.69
41 0.62
42 0.55
43 0.5
44 0.4
45 0.33
46 0.33
47 0.3
48 0.33
49 0.34
50 0.36
51 0.42
52 0.44
53 0.47
54 0.54
55 0.54
56 0.56
57 0.61
58 0.6
59 0.6
60 0.6
61 0.61
62 0.57
63 0.58
64 0.5
65 0.46
66 0.42
67 0.35
68 0.38
69 0.4
70 0.39
71 0.34
72 0.41
73 0.45
74 0.54
75 0.62
76 0.65
77 0.64
78 0.68
79 0.74
80 0.75
81 0.73
82 0.71
83 0.67
84 0.66
85 0.68
86 0.65
87 0.6
88 0.58
89 0.52
90 0.48
91 0.46
92 0.44
93 0.43
94 0.47
95 0.5
96 0.53
97 0.62
98 0.67
99 0.7
100 0.68
101 0.62
102 0.57
103 0.52
104 0.5
105 0.5
106 0.51
107 0.52
108 0.55
109 0.52
110 0.5
111 0.49
112 0.42