Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0XRG1

Protein Details
Accession A0A4U0XRG1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
163-193GEAPSEEEEKPRKRRKKRKRGKGPVTAGGGLBasic
NLS Segment(s)
PositionSequence
172-185KPRKRRKKRKRGKG
Subcellular Location(s) nucl 14, cyto_nucl 13, cyto 10
Family & Domain DBs
Amino Acid Sequences MSSLYITGLPAKKSTGSTGEKAVVGGGDGVITLWEKGQWDDQDERITVSKEKETLDVMAEVPEGVGGMMGKKVAVGLGDGRVRFVRLGMNKVVGEVRHDDVEGVIGLGFDVGGRMISGGGQVVKVWQEHIAGAGEAEEDEDEEAVGAKRTADSDDEDDGSDGGEAPSEEEEKPRKRRKKRKRGKGPVTAGGGLNFTGLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.31
4 0.32
5 0.35
6 0.36
7 0.33
8 0.31
9 0.28
10 0.19
11 0.14
12 0.12
13 0.07
14 0.05
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.04
21 0.06
22 0.07
23 0.08
24 0.14
25 0.15
26 0.19
27 0.22
28 0.24
29 0.26
30 0.26
31 0.26
32 0.23
33 0.24
34 0.22
35 0.22
36 0.22
37 0.21
38 0.22
39 0.22
40 0.21
41 0.2
42 0.18
43 0.16
44 0.14
45 0.12
46 0.11
47 0.09
48 0.07
49 0.06
50 0.05
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.08
65 0.11
66 0.11
67 0.12
68 0.12
69 0.12
70 0.12
71 0.11
72 0.13
73 0.13
74 0.16
75 0.16
76 0.19
77 0.18
78 0.18
79 0.19
80 0.14
81 0.14
82 0.13
83 0.13
84 0.11
85 0.11
86 0.1
87 0.09
88 0.09
89 0.07
90 0.05
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.03
105 0.03
106 0.04
107 0.04
108 0.04
109 0.04
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.08
117 0.08
118 0.07
119 0.07
120 0.06
121 0.05
122 0.05
123 0.05
124 0.04
125 0.03
126 0.04
127 0.04
128 0.03
129 0.03
130 0.04
131 0.04
132 0.05
133 0.05
134 0.05
135 0.06
136 0.07
137 0.08
138 0.09
139 0.12
140 0.15
141 0.17
142 0.18
143 0.18
144 0.17
145 0.16
146 0.14
147 0.11
148 0.08
149 0.06
150 0.06
151 0.05
152 0.06
153 0.07
154 0.09
155 0.1
156 0.15
157 0.24
158 0.32
159 0.43
160 0.53
161 0.62
162 0.71
163 0.82
164 0.88
165 0.91
166 0.94
167 0.95
168 0.96
169 0.97
170 0.96
171 0.96
172 0.93
173 0.89
174 0.83
175 0.74
176 0.64
177 0.53
178 0.43
179 0.32