Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V5NIA8

Protein Details
Accession A0A4V5NIA8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-71QAEAKREKMRLARRRQGPKLBasic
NLS Segment(s)
PositionSequence
56-71KREKMRLARRRQGPKL
Subcellular Location(s) mito 20, nucl 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MAPPKSLPITPPTPLPTIPWQPPIMQQAYMAPFADSKYPLQDYSFHLMLLAQAEAKREKMRLARRRQGPKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.34
4 0.36
5 0.37
6 0.37
7 0.34
8 0.33
9 0.37
10 0.37
11 0.31
12 0.25
13 0.22
14 0.21
15 0.22
16 0.21
17 0.17
18 0.13
19 0.11
20 0.12
21 0.13
22 0.1
23 0.09
24 0.1
25 0.11
26 0.12
27 0.12
28 0.15
29 0.17
30 0.22
31 0.22
32 0.19
33 0.18
34 0.17
35 0.17
36 0.15
37 0.11
38 0.07
39 0.07
40 0.1
41 0.12
42 0.15
43 0.17
44 0.17
45 0.22
46 0.3
47 0.4
48 0.47
49 0.57
50 0.64
51 0.72