Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WUR4

Protein Details
Accession A0A4U0WUR4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-49EPATQPSTATKKKKPKKRKRTPKPHILTQFTLHydrophilic
NLS Segment(s)
PositionSequence
28-41KKKKPKKRKRTPKP
Subcellular Location(s) nucl 12, pero 7, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020347  Pop8  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0006379  P:mRNA cleavage  
GO:0008033  P:tRNA processing  
Amino Acid Sequences MAAEEKLPEVTETTAVTEPATQPSTATKKKKPKKRKRTPKPHILTQFTLRSPPWSYIHLQHLTSHGPPATTTTPSSLDALTAHLQLTAALTQFLGLHGAAIPLDILQLRTESAELWIRVPAQDRSALLAAVGGCVSGKGEGWRVVGSSAWDARAMAMGSGQGLFED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.15
5 0.15
6 0.18
7 0.19
8 0.16
9 0.15
10 0.23
11 0.31
12 0.38
13 0.45
14 0.49
15 0.59
16 0.69
17 0.79
18 0.83
19 0.86
20 0.89
21 0.93
22 0.95
23 0.95
24 0.97
25 0.96
26 0.96
27 0.93
28 0.91
29 0.89
30 0.83
31 0.76
32 0.71
33 0.66
34 0.55
35 0.5
36 0.4
37 0.35
38 0.3
39 0.3
40 0.26
41 0.23
42 0.25
43 0.26
44 0.33
45 0.32
46 0.31
47 0.28
48 0.28
49 0.27
50 0.25
51 0.22
52 0.16
53 0.13
54 0.12
55 0.15
56 0.15
57 0.14
58 0.14
59 0.14
60 0.16
61 0.16
62 0.17
63 0.13
64 0.11
65 0.1
66 0.12
67 0.11
68 0.09
69 0.08
70 0.07
71 0.07
72 0.07
73 0.07
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.03
90 0.03
91 0.03
92 0.04
93 0.04
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.08
100 0.12
101 0.12
102 0.12
103 0.13
104 0.13
105 0.14
106 0.17
107 0.16
108 0.14
109 0.16
110 0.16
111 0.18
112 0.19
113 0.17
114 0.14
115 0.14
116 0.12
117 0.1
118 0.09
119 0.06
120 0.05
121 0.05
122 0.06
123 0.04
124 0.05
125 0.06
126 0.1
127 0.12
128 0.14
129 0.14
130 0.15
131 0.15
132 0.15
133 0.16
134 0.17
135 0.16
136 0.16
137 0.16
138 0.15
139 0.15
140 0.17
141 0.15
142 0.11
143 0.1
144 0.09
145 0.09
146 0.09