Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WLF5

Protein Details
Accession A0A4U0WLF5    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-44EEDMPVLRRRRRGRRVVEDSNSEHydrophilic
NLS Segment(s)
PositionSequence
30-35RRRRGR
Subcellular Location(s) cyto 12.5, cyto_pero 7.5, nucl 5, cysk 5, mito 2
Family & Domain DBs
Amino Acid Sequences MAVLQQFLAWRKGRIEEESDAEEDMPVLRRRRRGRRVVEDSNSEDEQGEERSFEASETRVDEEQWRTVIRKLREWDGVCLVCKAVSGSDERRHSFAACASDRFVVGMVQAVVEQVGQMAAPRSEQGRCWVPWVGKKKERVQEWVKGDRVFDEEIEAGMDGVEALGIFFRQQKKWEGGVDGNMMGELIVRFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.35
4 0.37
5 0.38
6 0.36
7 0.31
8 0.27
9 0.23
10 0.17
11 0.15
12 0.16
13 0.19
14 0.24
15 0.29
16 0.38
17 0.48
18 0.59
19 0.67
20 0.72
21 0.77
22 0.82
23 0.86
24 0.87
25 0.83
26 0.77
27 0.71
28 0.66
29 0.56
30 0.45
31 0.36
32 0.27
33 0.23
34 0.19
35 0.15
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.09
42 0.08
43 0.09
44 0.11
45 0.13
46 0.12
47 0.13
48 0.17
49 0.19
50 0.2
51 0.2
52 0.19
53 0.18
54 0.22
55 0.28
56 0.27
57 0.31
58 0.32
59 0.35
60 0.41
61 0.41
62 0.39
63 0.37
64 0.36
65 0.3
66 0.27
67 0.23
68 0.15
69 0.14
70 0.11
71 0.06
72 0.06
73 0.09
74 0.13
75 0.19
76 0.23
77 0.24
78 0.25
79 0.25
80 0.25
81 0.22
82 0.2
83 0.2
84 0.17
85 0.17
86 0.17
87 0.16
88 0.16
89 0.15
90 0.13
91 0.07
92 0.06
93 0.06
94 0.05
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.03
101 0.02
102 0.02
103 0.02
104 0.03
105 0.04
106 0.04
107 0.04
108 0.06
109 0.07
110 0.08
111 0.09
112 0.14
113 0.18
114 0.18
115 0.21
116 0.24
117 0.25
118 0.32
119 0.4
120 0.44
121 0.45
122 0.52
123 0.57
124 0.61
125 0.62
126 0.63
127 0.61
128 0.61
129 0.63
130 0.63
131 0.58
132 0.52
133 0.48
134 0.41
135 0.38
136 0.3
137 0.23
138 0.18
139 0.14
140 0.13
141 0.13
142 0.12
143 0.08
144 0.07
145 0.07
146 0.04
147 0.03
148 0.03
149 0.02
150 0.02
151 0.03
152 0.03
153 0.04
154 0.1
155 0.15
156 0.18
157 0.22
158 0.28
159 0.33
160 0.38
161 0.41
162 0.41
163 0.39
164 0.41
165 0.4
166 0.34
167 0.29
168 0.24
169 0.2
170 0.14
171 0.12