Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LR78

Protein Details
Accession E2LR78   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29VVLPMLRRHKIRRRYDKRRVGVYAHydrophilic
NLS Segment(s)
PositionSequence
13-22RHKIRRRYDK
Subcellular Location(s) mito 10, plas 6, E.R. 6, extr 2, cyto 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mpr:MPER_09471  -  
Amino Acid Sequences MAVGLVVLPMLRRHKIRRRYDKRRVGVYAAIVSFLMFSMIQFRDGPFIRPHPAFWRMVLGINLLYELALFGQPLPERNYADDCTSTLRLFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.55
3 0.65
4 0.72
5 0.79
6 0.86
7 0.91
8 0.92
9 0.89
10 0.87
11 0.79
12 0.71
13 0.63
14 0.54
15 0.47
16 0.36
17 0.29
18 0.21
19 0.17
20 0.13
21 0.1
22 0.08
23 0.04
24 0.04
25 0.08
26 0.08
27 0.09
28 0.1
29 0.1
30 0.13
31 0.14
32 0.17
33 0.15
34 0.17
35 0.2
36 0.2
37 0.21
38 0.22
39 0.25
40 0.23
41 0.22
42 0.23
43 0.2
44 0.21
45 0.2
46 0.16
47 0.13
48 0.12
49 0.11
50 0.07
51 0.06
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.08
59 0.09
60 0.12
61 0.16
62 0.19
63 0.21
64 0.24
65 0.28
66 0.27
67 0.3
68 0.28
69 0.25
70 0.27
71 0.28