Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0UR23

Protein Details
Accession A0A4U0UR23    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
131-150KEPVRKEKSKFRPYSSMKTAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 10.5, mito 7.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036028  SH3-like_dom_sf  
IPR001452  SH3_domain  
Pfam View protein in Pfam  
PF07653  SH3_2  
PROSITE View protein in PROSITE  
PS50002  SH3  
Amino Acid Sequences MGAPRDPPPRFPCWCQATYSWGGETKKDLGFIEGDLIEALNAGDGLWWMGRLRRDPRAIGLFPSNFVRVMEENFQPAPNSRRASPLNAPPSQSPSPIKSKSVFRKPFDAYEKVRPRGVLDGKRDGSPQSEKEPVRKEKSKFRPYSSMKTAQAPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.52
3 0.49
4 0.48
5 0.47
6 0.43
7 0.36
8 0.34
9 0.33
10 0.3
11 0.32
12 0.29
13 0.25
14 0.25
15 0.23
16 0.19
17 0.19
18 0.18
19 0.17
20 0.13
21 0.12
22 0.1
23 0.09
24 0.07
25 0.07
26 0.06
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.07
37 0.1
38 0.16
39 0.2
40 0.27
41 0.3
42 0.3
43 0.35
44 0.38
45 0.37
46 0.33
47 0.34
48 0.27
49 0.25
50 0.26
51 0.22
52 0.16
53 0.15
54 0.15
55 0.11
56 0.13
57 0.14
58 0.13
59 0.14
60 0.14
61 0.15
62 0.13
63 0.14
64 0.15
65 0.18
66 0.19
67 0.18
68 0.23
69 0.25
70 0.29
71 0.32
72 0.37
73 0.38
74 0.37
75 0.38
76 0.34
77 0.39
78 0.35
79 0.33
80 0.28
81 0.26
82 0.32
83 0.32
84 0.34
85 0.31
86 0.4
87 0.46
88 0.54
89 0.59
90 0.54
91 0.59
92 0.59
93 0.63
94 0.6
95 0.57
96 0.51
97 0.53
98 0.59
99 0.55
100 0.54
101 0.46
102 0.42
103 0.45
104 0.48
105 0.45
106 0.42
107 0.48
108 0.48
109 0.49
110 0.48
111 0.41
112 0.37
113 0.36
114 0.34
115 0.31
116 0.37
117 0.37
118 0.45
119 0.53
120 0.57
121 0.6
122 0.64
123 0.65
124 0.67
125 0.77
126 0.8
127 0.78
128 0.76
129 0.78
130 0.77
131 0.82
132 0.79
133 0.77
134 0.69