Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0VS86

Protein Details
Accession A0A4U0VS86    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
238-259VVGFLWWRNRRRRQGYKSVFGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 8.166, nucl 8, mito 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR001563  Peptidase_S10  
Gene Ontology GO:0016020  C:membrane  
GO:0004185  F:serine-type carboxypeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00450  Peptidase_S10  
Amino Acid Sequences MYDVRLRDGYPSCGMSWPPDLAQVKPYLRREDVTTALHINPDKKTGWVECNGQVSSQFRVPNSQPAIKLLPGLLEKVPILLFSGDKDLICNHIGTETLISNLAFNGGTGMETAPQSGIWARKRDWTFEAEPAGQYQSARNLTYVKFYNSSHMVPFDYPRRTRDMLDRFMGVDIANIGGTPADSRIDGEKAHPETSVGGHSNSTSAEESAQEKADAAAYQAYKRSGEGALTVMIIVLLVVGFLWWRNRRRRQGYKSVFGSDPYDPDGGRPMASGLGLDGGRYREERDVEAARDFDEAELDDLSAAHHRGGRSVGVDEEAFGLADDEEDEEEDGKRVGNGHAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.28
4 0.26
5 0.23
6 0.28
7 0.29
8 0.27
9 0.31
10 0.34
11 0.36
12 0.42
13 0.47
14 0.46
15 0.47
16 0.48
17 0.49
18 0.47
19 0.47
20 0.41
21 0.39
22 0.35
23 0.33
24 0.35
25 0.33
26 0.31
27 0.27
28 0.28
29 0.26
30 0.24
31 0.28
32 0.29
33 0.31
34 0.32
35 0.35
36 0.36
37 0.4
38 0.39
39 0.35
40 0.33
41 0.3
42 0.29
43 0.28
44 0.26
45 0.22
46 0.28
47 0.29
48 0.35
49 0.39
50 0.4
51 0.36
52 0.38
53 0.4
54 0.34
55 0.33
56 0.24
57 0.22
58 0.19
59 0.2
60 0.16
61 0.15
62 0.14
63 0.14
64 0.14
65 0.1
66 0.11
67 0.09
68 0.09
69 0.09
70 0.12
71 0.12
72 0.12
73 0.13
74 0.12
75 0.14
76 0.14
77 0.13
78 0.1
79 0.1
80 0.1
81 0.1
82 0.11
83 0.08
84 0.08
85 0.09
86 0.09
87 0.08
88 0.08
89 0.08
90 0.06
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.08
104 0.14
105 0.18
106 0.22
107 0.23
108 0.3
109 0.32
110 0.35
111 0.35
112 0.35
113 0.33
114 0.33
115 0.35
116 0.28
117 0.27
118 0.24
119 0.22
120 0.17
121 0.14
122 0.12
123 0.14
124 0.15
125 0.15
126 0.15
127 0.16
128 0.16
129 0.21
130 0.22
131 0.19
132 0.19
133 0.19
134 0.22
135 0.22
136 0.23
137 0.19
138 0.18
139 0.17
140 0.15
141 0.18
142 0.21
143 0.24
144 0.25
145 0.26
146 0.3
147 0.31
148 0.32
149 0.38
150 0.39
151 0.37
152 0.36
153 0.35
154 0.29
155 0.28
156 0.26
157 0.17
158 0.1
159 0.06
160 0.05
161 0.04
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.04
169 0.04
170 0.05
171 0.06
172 0.08
173 0.08
174 0.09
175 0.15
176 0.16
177 0.17
178 0.16
179 0.15
180 0.15
181 0.15
182 0.17
183 0.12
184 0.1
185 0.1
186 0.1
187 0.1
188 0.1
189 0.11
190 0.08
191 0.08
192 0.08
193 0.09
194 0.1
195 0.11
196 0.12
197 0.1
198 0.09
199 0.09
200 0.1
201 0.08
202 0.07
203 0.1
204 0.1
205 0.11
206 0.13
207 0.14
208 0.13
209 0.13
210 0.15
211 0.12
212 0.11
213 0.11
214 0.1
215 0.09
216 0.09
217 0.09
218 0.07
219 0.06
220 0.05
221 0.04
222 0.03
223 0.02
224 0.02
225 0.02
226 0.02
227 0.02
228 0.03
229 0.1
230 0.16
231 0.24
232 0.35
233 0.45
234 0.55
235 0.66
236 0.76
237 0.79
238 0.84
239 0.85
240 0.84
241 0.79
242 0.73
243 0.63
244 0.54
245 0.49
246 0.39
247 0.32
248 0.26
249 0.22
250 0.17
251 0.17
252 0.2
253 0.17
254 0.16
255 0.14
256 0.12
257 0.12
258 0.12
259 0.11
260 0.06
261 0.09
262 0.08
263 0.08
264 0.1
265 0.1
266 0.12
267 0.13
268 0.15
269 0.17
270 0.19
271 0.21
272 0.24
273 0.27
274 0.28
275 0.3
276 0.28
277 0.24
278 0.23
279 0.21
280 0.15
281 0.12
282 0.11
283 0.1
284 0.09
285 0.09
286 0.08
287 0.08
288 0.08
289 0.1
290 0.1
291 0.1
292 0.13
293 0.13
294 0.15
295 0.17
296 0.18
297 0.18
298 0.19
299 0.18
300 0.18
301 0.18
302 0.16
303 0.16
304 0.14
305 0.11
306 0.1
307 0.09
308 0.07
309 0.07
310 0.07
311 0.06
312 0.07
313 0.07
314 0.08
315 0.08
316 0.09
317 0.1
318 0.1
319 0.1
320 0.1
321 0.11