FuNGI

A0A4U0XNF3

Protein Details

Accession

A0A4U0XNF3

Localization Confidence

Low

Confidence Score

9.2

NoLS Segment(s)

Position	Sequence	Protein Nature
32-77	AVWDKLYPSKHSKKTQKAEAGLATSASGAPPKRRRRTDPDLAKADR	Hydrophilic

NLS Segment(s)

Position	Sequence
61-67	PPKRRRR

Subcellular Location(s)

mito 20, nucl 3, cyto 2

Family & Domain DBs

InterPro	View protein in InterPro IPR029058 AB_hydrolase IPR004177 DDHD_dom
Gene Ontology	GO:0046872 F:metal ion binding
Pfam	View protein in Pfam PF02862 DDHD
PROSITE	View protein in PROSITE PS51043 DDHD

Amino Acid Sequences

MPSTYYGRRPLAGYIRKGHKLGIPVVRGFDQAVWDKLYPSKHSKKTQKAEAGLATSASGAPPKRRRRTDPDLAKADRPTVSDLVLVIHGIGQQLSHRMESFHFTHAMNTFRRDVNVEVGTDQVKAHFRPDMGSIMLLPVNWRHSLSLDEGGYSDGTEDATSNDFTLKDITPDTLPSVRNIVSDVMLDVPYYMSHHQPKMIAAVIREANRVYQLWCRHNPHFAATGRVHLIGHSLGSVMAIDILSRQPTTIPAHLRNPTPLDLSSNQIDHFLFNTTNLFLAGSPAGFFLLLKKAQLRPRLDYPSATAAADPSANNVSICGERGEYGCLPVENLYNIINGYDPVSYRMNAAVDRTYAASLKKAWIPTTVGSWFGGPASGGMGWFAGGSGSTSTSTSTNPANAAPALPRLPSTVELETHNFSLEEIAEKRMHLLNDNGQVDFFLRYGGGPHSSYWLLRDFVRIIVGEVGRRGGREGTGVGMRAVKDNKAGVAGRG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.54
2	0.6
3	0.63
4	0.62
5	0.58
6	0.51
7	0.48
8	0.5
9	0.49
10	0.46
11	0.42
12	0.44
13	0.42
14	0.39
15	0.35
16	0.28
17	0.25
18	0.23
19	0.24
20	0.24
21	0.24
22	0.25
23	0.28
24	0.32
25	0.33
26	0.39
27	0.47
28	0.53
29	0.63
30	0.72
31	0.78
32	0.83
33	0.87
34	0.86
35	0.8
36	0.77
37	0.7
38	0.62
39	0.52
40	0.43
41	0.32
42	0.24
43	0.19
44	0.14
45	0.14
46	0.14
47	0.23
48	0.33
49	0.43
50	0.53
51	0.62
52	0.7
53	0.76
54	0.82
55	0.84
56	0.85
57	0.84
58	0.83
59	0.78
60	0.74
61	0.66
62	0.6
63	0.51
64	0.42
65	0.36
66	0.28
67	0.25
68	0.21
69	0.19
70	0.17
71	0.15
72	0.13
73	0.08
74	0.08
75	0.08
76	0.07
77	0.07
78	0.06
79	0.07
80	0.12
81	0.13
82	0.14
83	0.13
84	0.14
85	0.16
86	0.21
87	0.22
88	0.2
89	0.22
90	0.21
91	0.24
92	0.25
93	0.29
94	0.27
95	0.28
96	0.28
97	0.27
98	0.28
99	0.27
100	0.26
101	0.27
102	0.26
103	0.23
104	0.2
105	0.2
106	0.2
107	0.18
108	0.16
109	0.13
110	0.14
111	0.14
112	0.16
113	0.17
114	0.16
115	0.17
116	0.2
117	0.19
118	0.16
119	0.16
120	0.14
121	0.13
122	0.13
123	0.11
124	0.1
125	0.1
126	0.12
127	0.12
128	0.13
129	0.12
130	0.12
131	0.15
132	0.17
133	0.19
134	0.17
135	0.16
136	0.16
137	0.16
138	0.15
139	0.12
140	0.1
141	0.05
142	0.05
143	0.05
144	0.05
145	0.05
146	0.07
147	0.07
148	0.07
149	0.08
150	0.08
151	0.09
152	0.11
153	0.1
154	0.1
155	0.11
156	0.12
157	0.11
158	0.12
159	0.15
160	0.16
161	0.16
162	0.15
163	0.18
164	0.17
165	0.16
166	0.17
167	0.15
168	0.11
169	0.11
170	0.1
171	0.08
172	0.08
173	0.08
174	0.06
175	0.06
176	0.05
177	0.07
178	0.08
179	0.12
180	0.16
181	0.17
182	0.18
183	0.19
184	0.19
185	0.2
186	0.21
187	0.18
188	0.14
189	0.17
190	0.19
191	0.19
192	0.19
193	0.17
194	0.15
195	0.15
196	0.15
197	0.13
198	0.16
199	0.21
200	0.26
201	0.33
202	0.38
203	0.38
204	0.42
205	0.41
206	0.38
207	0.38
208	0.33
209	0.32
210	0.27
211	0.28
212	0.24
213	0.24
214	0.21
215	0.14
216	0.14
217	0.09
218	0.08
219	0.06
220	0.05
221	0.04
222	0.04
223	0.04
224	0.03
225	0.03
226	0.03
227	0.03
228	0.03
229	0.04
230	0.04
231	0.04
232	0.05
233	0.05
234	0.08
235	0.11
236	0.14
237	0.18
238	0.21
239	0.26
240	0.29
241	0.3
242	0.29
243	0.29
244	0.26
245	0.23
246	0.2
247	0.19
248	0.18
249	0.19
250	0.18
251	0.17
252	0.15
253	0.15
254	0.15
255	0.11
256	0.11
257	0.1
258	0.08
259	0.08
260	0.09
261	0.08
262	0.08
263	0.08
264	0.07
265	0.05
266	0.06
267	0.06
268	0.05
269	0.05
270	0.05
271	0.05
272	0.05
273	0.05
274	0.05
275	0.09
276	0.09
277	0.1
278	0.13
279	0.19
280	0.24
281	0.32
282	0.34
283	0.35
284	0.42
285	0.48
286	0.46
287	0.41
288	0.39
289	0.36
290	0.33
291	0.28
292	0.21
293	0.15
294	0.14
295	0.14
296	0.11
297	0.09
298	0.09
299	0.09
300	0.09
301	0.09
302	0.09
303	0.09
304	0.1
305	0.09
306	0.08
307	0.08
308	0.09
309	0.12
310	0.11
311	0.12
312	0.12
313	0.11
314	0.11
315	0.11
316	0.12
317	0.09
318	0.1
319	0.09
320	0.08
321	0.08
322	0.08
323	0.07
324	0.06
325	0.07
326	0.07
327	0.07
328	0.1
329	0.12
330	0.12
331	0.12
332	0.14
333	0.14
334	0.13
335	0.15
336	0.13
337	0.12
338	0.13
339	0.13
340	0.12
341	0.13
342	0.13
343	0.13
344	0.13
345	0.16
346	0.19
347	0.2
348	0.2
349	0.21
350	0.23
351	0.22
352	0.25
353	0.23
354	0.21
355	0.19
356	0.18
357	0.15
358	0.13
359	0.12
360	0.07
361	0.06
362	0.06
363	0.06
364	0.06
365	0.05
366	0.05
367	0.05
368	0.05
369	0.05
370	0.03
371	0.03
372	0.04
373	0.05
374	0.06
375	0.07
376	0.07
377	0.09
378	0.1
379	0.1
380	0.12
381	0.13
382	0.14
383	0.14
384	0.14
385	0.15
386	0.15
387	0.15
388	0.14
389	0.16
390	0.16
391	0.15
392	0.16
393	0.15
394	0.17
395	0.18
396	0.21
397	0.2
398	0.2
399	0.23
400	0.26
401	0.27
402	0.25
403	0.23
404	0.19
405	0.16
406	0.16
407	0.13
408	0.14
409	0.14
410	0.17
411	0.17
412	0.17
413	0.2
414	0.23
415	0.23
416	0.21
417	0.25
418	0.28
419	0.36
420	0.37
421	0.34
422	0.3
423	0.3
424	0.28
425	0.24
426	0.17
427	0.09
428	0.08
429	0.08
430	0.1
431	0.13
432	0.15
433	0.15
434	0.15
435	0.2
436	0.21
437	0.21
438	0.22
439	0.22
440	0.21
441	0.2
442	0.24
443	0.21
444	0.21
445	0.23
446	0.2
447	0.18
448	0.23
449	0.23
450	0.21
451	0.2
452	0.23
453	0.21
454	0.21
455	0.22
456	0.18
457	0.17
458	0.18
459	0.18
460	0.18
461	0.2
462	0.21
463	0.2
464	0.21
465	0.21
466	0.25
467	0.27
468	0.25
469	0.26
470	0.27
471	0.26
472	0.29

A0A4U0XNF3

3D AlphaFold-predicted Structure Viewer