Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0WG17

Protein Details
Accession A0A4U0WG17    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTKPGPKKGTTVRKGRKNKIDRNDLYHydrophilic
NLS Segment(s)
PositionSequence
5-19GPKKGTTVRKGRKNK
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MTKPGPKKGTTVRKGRKNKIDRNDLYAKVTELFKLIEELKEEKKALEARVAFLELGNLEGGLNDLDLGLGEFDFNVDLGDLATIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.87
5 0.88
6 0.87
7 0.87
8 0.79
9 0.77
10 0.74
11 0.65
12 0.57
13 0.48
14 0.39
15 0.3
16 0.28
17 0.2
18 0.14
19 0.13
20 0.1
21 0.11
22 0.11
23 0.1
24 0.12
25 0.15
26 0.16
27 0.18
28 0.18
29 0.16
30 0.18
31 0.2
32 0.18
33 0.21
34 0.19
35 0.18
36 0.19
37 0.19
38 0.16
39 0.13
40 0.13
41 0.07
42 0.08
43 0.06
44 0.05
45 0.04
46 0.04
47 0.05
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04