Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2LGG7

Protein Details
Accession E2LGG7    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
195-220EVVFRGDRLTRKRKNVTHNPVPKSTRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9, cyto 6.5, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
KEGG mpr:MPER_05542  -  
Amino Acid Sequences YTGPKPDYDSPAHQALTPSEQAGLQRSKWFEEKGCGYSAEQSTQPQTLGYSLSDSPIGLLAWIYEKLVNWTDNYDWDDDEVLTWISVYWFSRSGPAASIRIYYEYEQGGGRASLLNPTIPFGKSYFPKEIYVLPKAWMTENNLIFESYHQSGGHFAAHEKPDELVDDLRRMFGKGGPAYGVVPGKDGANNTCMHEVVFRGDRLTRKRKNVTHNPVPKSTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.33
4 0.28
5 0.24
6 0.19
7 0.2
8 0.2
9 0.24
10 0.25
11 0.22
12 0.26
13 0.28
14 0.31
15 0.34
16 0.37
17 0.33
18 0.37
19 0.39
20 0.36
21 0.36
22 0.34
23 0.3
24 0.33
25 0.32
26 0.28
27 0.24
28 0.24
29 0.24
30 0.24
31 0.23
32 0.17
33 0.15
34 0.13
35 0.13
36 0.12
37 0.12
38 0.11
39 0.12
40 0.12
41 0.11
42 0.1
43 0.1
44 0.09
45 0.06
46 0.05
47 0.05
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.1
54 0.13
55 0.13
56 0.12
57 0.14
58 0.14
59 0.16
60 0.18
61 0.16
62 0.13
63 0.13
64 0.13
65 0.11
66 0.11
67 0.09
68 0.07
69 0.06
70 0.06
71 0.05
72 0.04
73 0.06
74 0.06
75 0.07
76 0.08
77 0.08
78 0.11
79 0.11
80 0.12
81 0.13
82 0.14
83 0.14
84 0.13
85 0.14
86 0.12
87 0.13
88 0.14
89 0.13
90 0.12
91 0.11
92 0.11
93 0.1
94 0.1
95 0.09
96 0.07
97 0.07
98 0.06
99 0.05
100 0.06
101 0.07
102 0.07
103 0.07
104 0.08
105 0.09
106 0.09
107 0.1
108 0.09
109 0.13
110 0.15
111 0.19
112 0.22
113 0.23
114 0.24
115 0.24
116 0.28
117 0.29
118 0.29
119 0.26
120 0.23
121 0.22
122 0.21
123 0.21
124 0.18
125 0.19
126 0.23
127 0.24
128 0.24
129 0.23
130 0.23
131 0.22
132 0.21
133 0.2
134 0.14
135 0.15
136 0.13
137 0.13
138 0.14
139 0.15
140 0.15
141 0.11
142 0.11
143 0.15
144 0.16
145 0.17
146 0.16
147 0.15
148 0.15
149 0.16
150 0.17
151 0.14
152 0.15
153 0.17
154 0.17
155 0.18
156 0.18
157 0.18
158 0.17
159 0.16
160 0.22
161 0.19
162 0.2
163 0.19
164 0.2
165 0.2
166 0.22
167 0.22
168 0.14
169 0.14
170 0.14
171 0.14
172 0.14
173 0.16
174 0.14
175 0.15
176 0.16
177 0.18
178 0.19
179 0.18
180 0.17
181 0.17
182 0.16
183 0.19
184 0.21
185 0.19
186 0.2
187 0.24
188 0.31
189 0.39
190 0.49
191 0.52
192 0.59
193 0.68
194 0.74
195 0.81
196 0.85
197 0.86
198 0.86
199 0.87
200 0.83