Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LET6

Protein Details
Accession E2LET6    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-90GSDSEDNRKRSKRRFRRSRSRSLSADDSDGNEKRHRRKKSKRKHKSDKKERKERPPSPDGBasic
NLS Segment(s)
PositionSequence
38-56RKRSKRRFRRSRSRSLSAD
58-89SDGNEKRHRRKKSKRKHKSDKKERKERPPSPD
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
KEGG mpr:MPER_04863  -  
Amino Acid Sequences ATKEVATMNPQHLPVMGHSSKPEKRSASVSGSDSEDNRKRSKRRFRRSRSRSLSADDSDGNEKRHRRKKSKRKHKSDKKERKERPPSPDGVPRKETEEEYDARLEREEKERMEEARKRHLEKMKAQCESESQSSNGIRYKGRGRMKYVDPDVNYNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.24
4 0.22
5 0.25
6 0.33
7 0.37
8 0.38
9 0.43
10 0.37
11 0.38
12 0.42
13 0.43
14 0.4
15 0.4
16 0.39
17 0.35
18 0.35
19 0.33
20 0.3
21 0.33
22 0.33
23 0.33
24 0.38
25 0.44
26 0.5
27 0.59
28 0.69
29 0.72
30 0.77
31 0.84
32 0.88
33 0.91
34 0.92
35 0.93
36 0.9
37 0.86
38 0.78
39 0.72
40 0.66
41 0.56
42 0.5
43 0.39
44 0.32
45 0.29
46 0.28
47 0.25
48 0.25
49 0.29
50 0.36
51 0.44
52 0.52
53 0.58
54 0.68
55 0.76
56 0.83
57 0.89
58 0.91
59 0.93
60 0.95
61 0.95
62 0.96
63 0.96
64 0.96
65 0.95
66 0.95
67 0.91
68 0.91
69 0.91
70 0.86
71 0.83
72 0.77
73 0.7
74 0.63
75 0.64
76 0.59
77 0.53
78 0.49
79 0.42
80 0.41
81 0.39
82 0.35
83 0.3
84 0.28
85 0.24
86 0.23
87 0.25
88 0.21
89 0.2
90 0.2
91 0.18
92 0.16
93 0.2
94 0.22
95 0.2
96 0.24
97 0.27
98 0.28
99 0.36
100 0.38
101 0.38
102 0.44
103 0.5
104 0.49
105 0.55
106 0.6
107 0.59
108 0.64
109 0.7
110 0.68
111 0.66
112 0.63
113 0.56
114 0.52
115 0.5
116 0.45
117 0.37
118 0.29
119 0.3
120 0.3
121 0.32
122 0.32
123 0.29
124 0.26
125 0.29
126 0.35
127 0.39
128 0.47
129 0.5
130 0.53
131 0.58
132 0.63
133 0.68
134 0.68
135 0.67
136 0.6