Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0XIE3

Protein Details
Accession A0A4U0XIE3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
68-107EAREVASRNRNRNRNRNRNRDRDRDRNRRRNHLNRSPEPTBasic
NLS Segment(s)
PositionSequence
75-99RNRNRNRNRNRNRDRDRDRNRRRNH
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
Amino Acid Sequences MAMRRTASGHAPTCTTYQQTCKPPPQPSAALGTANKSAVVLARDCLTTPAALVADEVDKEVAEPAAEEAREVASRNRNRNRNRNRNRDRDRDRNRRRNHLNRSPEPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.26
4 0.29
5 0.35
6 0.42
7 0.47
8 0.53
9 0.58
10 0.6
11 0.61
12 0.6
13 0.55
14 0.49
15 0.48
16 0.41
17 0.36
18 0.31
19 0.29
20 0.24
21 0.21
22 0.19
23 0.13
24 0.11
25 0.1
26 0.11
27 0.09
28 0.08
29 0.09
30 0.09
31 0.09
32 0.1
33 0.09
34 0.07
35 0.07
36 0.07
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.03
50 0.03
51 0.04
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.08
58 0.09
59 0.13
60 0.21
61 0.27
62 0.37
63 0.46
64 0.54
65 0.63
66 0.73
67 0.8
68 0.82
69 0.86
70 0.88
71 0.89
72 0.91
73 0.91
74 0.91
75 0.89
76 0.89
77 0.89
78 0.89
79 0.91
80 0.9
81 0.9
82 0.89
83 0.91
84 0.91
85 0.91
86 0.9
87 0.89