Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0X1Y4

Protein Details
Accession A0A4U0X1Y4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-25TTPNKRRKVASSPTKPPPITHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR003265  HhH-GPD_domain  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF00730  HhH-GPD  
CDD cd00056  ENDO3c  
Amino Acid Sequences MPPPLTTPNKRRKVASSPTKPPPITPTPSAIGFMTSNSVLRPTYSTGDIDDATPAPADRPVQPHHTNATLITPRGTQVPPSYSNFEESPSKPSTEPTTTTNCLLDEAVAHLLKVDPTLKPVIDKHPCRVFSPAGLAETIDPFRSLASGIMAQQVSGAAAKSIKNKFVALFPPKSCPTGFPPPAIVAETSIPRLREAGLSQRKAEYIQGLAEKFTTNELTIPMLMNGSDADVMSALVAVRGLGVWSVEMFMCFGLKRLDVFSTGDLGVQRGMAAHAGKDVAKLKAKGGGKWKYMAEKEMLERAERYRPFRSLFMWYMWRVEDVDVEAVGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.74
4 0.74
5 0.79
6 0.84
7 0.77
8 0.69
9 0.66
10 0.63
11 0.6
12 0.54
13 0.49
14 0.43
15 0.44
16 0.43
17 0.34
18 0.29
19 0.22
20 0.2
21 0.17
22 0.15
23 0.14
24 0.13
25 0.15
26 0.12
27 0.13
28 0.15
29 0.16
30 0.18
31 0.2
32 0.2
33 0.2
34 0.22
35 0.21
36 0.19
37 0.17
38 0.14
39 0.13
40 0.13
41 0.11
42 0.09
43 0.11
44 0.13
45 0.15
46 0.2
47 0.23
48 0.31
49 0.34
50 0.37
51 0.38
52 0.38
53 0.35
54 0.31
55 0.34
56 0.29
57 0.27
58 0.25
59 0.22
60 0.2
61 0.23
62 0.23
63 0.18
64 0.19
65 0.24
66 0.26
67 0.3
68 0.33
69 0.3
70 0.33
71 0.3
72 0.29
73 0.3
74 0.27
75 0.29
76 0.27
77 0.28
78 0.25
79 0.27
80 0.3
81 0.28
82 0.29
83 0.27
84 0.32
85 0.32
86 0.33
87 0.32
88 0.26
89 0.23
90 0.2
91 0.16
92 0.1
93 0.09
94 0.11
95 0.1
96 0.09
97 0.08
98 0.09
99 0.09
100 0.1
101 0.1
102 0.07
103 0.1
104 0.12
105 0.12
106 0.14
107 0.16
108 0.24
109 0.32
110 0.34
111 0.38
112 0.44
113 0.45
114 0.44
115 0.46
116 0.38
117 0.3
118 0.32
119 0.26
120 0.19
121 0.18
122 0.17
123 0.13
124 0.14
125 0.13
126 0.08
127 0.07
128 0.06
129 0.06
130 0.06
131 0.06
132 0.05
133 0.06
134 0.06
135 0.06
136 0.09
137 0.09
138 0.09
139 0.08
140 0.08
141 0.07
142 0.06
143 0.06
144 0.03
145 0.05
146 0.07
147 0.13
148 0.15
149 0.16
150 0.17
151 0.18
152 0.18
153 0.2
154 0.25
155 0.25
156 0.28
157 0.27
158 0.31
159 0.32
160 0.33
161 0.3
162 0.26
163 0.27
164 0.32
165 0.32
166 0.28
167 0.28
168 0.28
169 0.28
170 0.26
171 0.2
172 0.11
173 0.11
174 0.11
175 0.12
176 0.12
177 0.12
178 0.11
179 0.12
180 0.11
181 0.12
182 0.12
183 0.21
184 0.27
185 0.29
186 0.3
187 0.3
188 0.3
189 0.29
190 0.28
191 0.19
192 0.12
193 0.13
194 0.15
195 0.14
196 0.14
197 0.14
198 0.13
199 0.12
200 0.12
201 0.11
202 0.08
203 0.09
204 0.09
205 0.1
206 0.1
207 0.1
208 0.08
209 0.08
210 0.07
211 0.07
212 0.06
213 0.05
214 0.05
215 0.05
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.03
231 0.04
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.06
238 0.06
239 0.07
240 0.08
241 0.09
242 0.1
243 0.12
244 0.13
245 0.14
246 0.15
247 0.15
248 0.16
249 0.15
250 0.16
251 0.14
252 0.14
253 0.12
254 0.1
255 0.09
256 0.07
257 0.07
258 0.08
259 0.09
260 0.08
261 0.09
262 0.1
263 0.11
264 0.14
265 0.17
266 0.2
267 0.26
268 0.26
269 0.27
270 0.33
271 0.35
272 0.37
273 0.43
274 0.47
275 0.44
276 0.47
277 0.5
278 0.51
279 0.51
280 0.49
281 0.43
282 0.39
283 0.39
284 0.41
285 0.38
286 0.32
287 0.32
288 0.32
289 0.38
290 0.38
291 0.41
292 0.41
293 0.45
294 0.46
295 0.47
296 0.47
297 0.45
298 0.44
299 0.43
300 0.44
301 0.4
302 0.39
303 0.37
304 0.35
305 0.28
306 0.26
307 0.22
308 0.18
309 0.18