Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0X5Q9

Protein Details
Accession A0A4U0X5Q9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-82PQAERKTTKKAAKRVKQKATAKARKAHydrophilic
NLS Segment(s)
PositionSequence
61-93RKTTKKAAKRVKQKATAKARKAADNAEKQAKAE
Subcellular Location(s) nucl 15, mito_nucl 10.333, cyto_nucl 9.833, mito 4.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVKQLPHAPGASGGNAQAGSTDLSEALAALTITSGALTPSASSSDSNYDEADGAQLPQAERKTTKKAAKRVKQKATAKARKAADNAEKQAKAEADQKAKVEAQKKAKDAAAQQAALYDNIIEYFDTTYGRKEARLAAWQLLCEHVGVEAGPSIIKRKKVSQATLLFLTTSGALRTYTKAGRVFPLKLAKESPVLRSMLIKVFFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.11
5 0.1
6 0.09
7 0.09
8 0.09
9 0.07
10 0.07
11 0.07
12 0.07
13 0.06
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.03
23 0.04
24 0.04
25 0.05
26 0.05
27 0.07
28 0.08
29 0.08
30 0.1
31 0.14
32 0.16
33 0.17
34 0.16
35 0.16
36 0.15
37 0.14
38 0.14
39 0.1
40 0.08
41 0.08
42 0.09
43 0.09
44 0.13
45 0.14
46 0.16
47 0.19
48 0.23
49 0.3
50 0.37
51 0.45
52 0.48
53 0.57
54 0.65
55 0.71
56 0.77
57 0.8
58 0.81
59 0.83
60 0.82
61 0.82
62 0.83
63 0.83
64 0.76
65 0.73
66 0.66
67 0.61
68 0.55
69 0.52
70 0.48
71 0.45
72 0.45
73 0.43
74 0.41
75 0.37
76 0.37
77 0.3
78 0.25
79 0.25
80 0.26
81 0.23
82 0.25
83 0.25
84 0.25
85 0.26
86 0.28
87 0.27
88 0.28
89 0.33
90 0.36
91 0.37
92 0.37
93 0.37
94 0.36
95 0.33
96 0.34
97 0.28
98 0.23
99 0.22
100 0.21
101 0.2
102 0.18
103 0.16
104 0.08
105 0.05
106 0.05
107 0.06
108 0.04
109 0.04
110 0.05
111 0.05
112 0.06
113 0.07
114 0.08
115 0.1
116 0.11
117 0.11
118 0.12
119 0.15
120 0.17
121 0.21
122 0.22
123 0.24
124 0.24
125 0.25
126 0.23
127 0.21
128 0.18
129 0.13
130 0.11
131 0.07
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.11
140 0.15
141 0.2
142 0.22
143 0.28
144 0.37
145 0.45
146 0.49
147 0.53
148 0.54
149 0.54
150 0.53
151 0.47
152 0.38
153 0.31
154 0.26
155 0.18
156 0.13
157 0.09
158 0.08
159 0.08
160 0.1
161 0.12
162 0.17
163 0.18
164 0.23
165 0.26
166 0.27
167 0.33
168 0.37
169 0.37
170 0.39
171 0.47
172 0.43
173 0.44
174 0.44
175 0.4
176 0.42
177 0.42
178 0.39
179 0.35
180 0.33
181 0.31
182 0.31
183 0.32
184 0.32