Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WT59

Protein Details
Accession A0A4U0WT59    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-59AEDKDERPAKKRRTKHTATSVEAHydrophilic
69-93AVVEPSKKRTPKQKVKIEVKQQEDIHydrophilic
98-120ESGEVAPKKRRARKEVKGEIQLDHydrophilic
123-146GEVVEKRVKVKRKSKAEKERELVDBasic
NLS Segment(s)
PositionSequence
45-49AKKRR
104-113PKKRRARKEV
128-140KRVKVKRKSKAEK
Subcellular Location(s) cyto 17.5, cyto_nucl 11.5, nucl 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001719  AP_endonuc_2  
IPR018246  AP_endonuc_F2_Zn_BS  
IPR036237  Xyl_isomerase-like_sf  
IPR013022  Xyl_isomerase-like_TIM-brl  
Gene Ontology GO:0003677  F:DNA binding  
GO:0016787  F:hydrolase activity  
GO:0008270  F:zinc ion binding  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF01261  AP_endonuc_2  
PROSITE View protein in PROSITE  
PS00731  AP_NUCLEASE_F2_3  
PS51432  AP_NUCLEASE_F2_4  
CDD cd00019  AP2Ec  
Amino Acid Sequences MPKRKIAKEASEESDLSLPPVDLLDGVQAVTGANGHAEDKDERPAKKRRTKHTATSVEAELVDVDGSSAVVEPSKKRTPKQKVKIEVKQQEDIAAATESGEVAPKKRRARKEVKGEIQLDENGEVVEKRVKVKRKSKAEKERELVDMPLAARAVGHKLLIGAHVSAAGGVHQSILNSVHIGANAFALFLKSQRKWENPPLQDDHCSTFHSHCKTHSYDPSNHIVPHGSYLVNLAHTNKDRTKQAYDAFLDDLKRCEKLGIALYNFHPGTDQCADRPKAIAHLASNINRAHVETSKVVTLLETMTAGGNTIGCTFEDLRDIIALVTKKDRVGVCLDTAHVFTAGYDLRTPAAFLRTMERFEDVVGFKYLRALHLNDSKAPLGSNKDLHANIGTGFLGLRAFHNIVNEPRFAGLPLVLETPIEVRDDDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.37
3 0.29
4 0.23
5 0.17
6 0.13
7 0.13
8 0.11
9 0.08
10 0.08
11 0.08
12 0.08
13 0.08
14 0.07
15 0.07
16 0.06
17 0.06
18 0.06
19 0.05
20 0.05
21 0.06
22 0.06
23 0.07
24 0.1
25 0.13
26 0.15
27 0.24
28 0.3
29 0.33
30 0.4
31 0.5
32 0.57
33 0.64
34 0.72
35 0.73
36 0.78
37 0.83
38 0.85
39 0.86
40 0.84
41 0.79
42 0.75
43 0.65
44 0.56
45 0.48
46 0.37
47 0.26
48 0.18
49 0.13
50 0.07
51 0.06
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.06
58 0.09
59 0.11
60 0.19
61 0.28
62 0.33
63 0.39
64 0.5
65 0.6
66 0.69
67 0.77
68 0.8
69 0.82
70 0.87
71 0.9
72 0.9
73 0.87
74 0.81
75 0.75
76 0.65
77 0.55
78 0.46
79 0.36
80 0.27
81 0.19
82 0.13
83 0.09
84 0.09
85 0.07
86 0.07
87 0.1
88 0.09
89 0.12
90 0.2
91 0.28
92 0.37
93 0.46
94 0.55
95 0.62
96 0.72
97 0.78
98 0.82
99 0.85
100 0.83
101 0.83
102 0.76
103 0.67
104 0.59
105 0.5
106 0.4
107 0.29
108 0.21
109 0.13
110 0.11
111 0.1
112 0.08
113 0.11
114 0.12
115 0.17
116 0.23
117 0.32
118 0.41
119 0.51
120 0.59
121 0.66
122 0.76
123 0.81
124 0.86
125 0.88
126 0.87
127 0.82
128 0.75
129 0.68
130 0.58
131 0.48
132 0.37
133 0.29
134 0.2
135 0.17
136 0.13
137 0.09
138 0.08
139 0.08
140 0.1
141 0.08
142 0.08
143 0.07
144 0.08
145 0.08
146 0.09
147 0.09
148 0.06
149 0.06
150 0.06
151 0.06
152 0.05
153 0.05
154 0.04
155 0.04
156 0.03
157 0.04
158 0.04
159 0.04
160 0.05
161 0.06
162 0.06
163 0.06
164 0.07
165 0.07
166 0.07
167 0.07
168 0.07
169 0.06
170 0.06
171 0.05
172 0.05
173 0.05
174 0.05
175 0.07
176 0.12
177 0.13
178 0.19
179 0.24
180 0.28
181 0.34
182 0.44
183 0.51
184 0.48
185 0.53
186 0.52
187 0.49
188 0.47
189 0.43
190 0.37
191 0.28
192 0.26
193 0.22
194 0.21
195 0.24
196 0.25
197 0.24
198 0.22
199 0.26
200 0.29
201 0.32
202 0.36
203 0.36
204 0.37
205 0.4
206 0.43
207 0.39
208 0.36
209 0.31
210 0.25
211 0.2
212 0.17
213 0.15
214 0.1
215 0.08
216 0.1
217 0.1
218 0.1
219 0.1
220 0.09
221 0.12
222 0.14
223 0.19
224 0.2
225 0.23
226 0.25
227 0.29
228 0.31
229 0.31
230 0.31
231 0.33
232 0.31
233 0.29
234 0.27
235 0.25
236 0.24
237 0.2
238 0.2
239 0.15
240 0.15
241 0.13
242 0.12
243 0.11
244 0.12
245 0.17
246 0.19
247 0.19
248 0.21
249 0.22
250 0.27
251 0.26
252 0.23
253 0.19
254 0.14
255 0.19
256 0.19
257 0.19
258 0.15
259 0.24
260 0.25
261 0.25
262 0.27
263 0.22
264 0.22
265 0.23
266 0.23
267 0.16
268 0.2
269 0.24
270 0.25
271 0.28
272 0.25
273 0.24
274 0.22
275 0.22
276 0.19
277 0.16
278 0.18
279 0.15
280 0.17
281 0.16
282 0.16
283 0.16
284 0.13
285 0.12
286 0.09
287 0.08
288 0.06
289 0.06
290 0.06
291 0.06
292 0.06
293 0.05
294 0.05
295 0.05
296 0.06
297 0.06
298 0.06
299 0.09
300 0.09
301 0.1
302 0.12
303 0.11
304 0.11
305 0.11
306 0.11
307 0.08
308 0.12
309 0.12
310 0.12
311 0.15
312 0.16
313 0.16
314 0.21
315 0.21
316 0.19
317 0.23
318 0.24
319 0.23
320 0.22
321 0.23
322 0.2
323 0.2
324 0.18
325 0.13
326 0.11
327 0.09
328 0.11
329 0.11
330 0.1
331 0.11
332 0.11
333 0.11
334 0.12
335 0.13
336 0.11
337 0.13
338 0.13
339 0.14
340 0.19
341 0.21
342 0.23
343 0.23
344 0.24
345 0.21
346 0.21
347 0.25
348 0.2
349 0.2
350 0.21
351 0.2
352 0.17
353 0.22
354 0.22
355 0.2
356 0.22
357 0.22
358 0.26
359 0.34
360 0.36
361 0.35
362 0.37
363 0.36
364 0.32
365 0.31
366 0.27
367 0.27
368 0.29
369 0.29
370 0.28
371 0.33
372 0.32
373 0.33
374 0.31
375 0.26
376 0.21
377 0.2
378 0.18
379 0.12
380 0.11
381 0.1
382 0.09
383 0.09
384 0.09
385 0.13
386 0.14
387 0.15
388 0.18
389 0.23
390 0.29
391 0.31
392 0.31
393 0.27
394 0.27
395 0.26
396 0.24
397 0.21
398 0.15
399 0.14
400 0.15
401 0.15
402 0.14
403 0.13
404 0.13
405 0.13
406 0.13
407 0.13