Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0XZ01

Protein Details
Accession A0A4U0XZ01    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
18-49VLLVNRLERRRRRQKLWPKPRGVKRNKCRALFHydrophilic
NLS Segment(s)
PositionSequence
25-44ERRRRRQKLWPKPRGVKRNK
Subcellular Location(s) cyto 8, nucl 5, cyto_pero 5, mito 4, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MMEPLTITLSATGTVLAVLLVNRLERRRRRQKLWPKPRGVKRNKCRALFGGEPVDFKQPVSLDTENPFWNQEQVAEYQERVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.04
6 0.05
7 0.05
8 0.07
9 0.1
10 0.14
11 0.23
12 0.31
13 0.42
14 0.53
15 0.61
16 0.66
17 0.74
18 0.82
19 0.84
20 0.87
21 0.87
22 0.85
23 0.86
24 0.89
25 0.88
26 0.87
27 0.87
28 0.85
29 0.86
30 0.84
31 0.76
32 0.7
33 0.62
34 0.58
35 0.49
36 0.43
37 0.38
38 0.31
39 0.31
40 0.29
41 0.29
42 0.22
43 0.2
44 0.19
45 0.13
46 0.13
47 0.18
48 0.18
49 0.18
50 0.21
51 0.24
52 0.23
53 0.24
54 0.25
55 0.19
56 0.2
57 0.18
58 0.16
59 0.15
60 0.16
61 0.2
62 0.2