Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2L5N6

Protein Details
Accession E2L5N6    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-23RPTRTLWKFLRESKCRRSFVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR002218  MnmG-rel  
IPR040131  MnmG_N  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
GO:0008033  P:tRNA processing  
KEGG mpr:MPER_01087  -  
Pfam View protein in Pfam  
PF01134  GIDA  
Amino Acid Sequences MLPRPTRTLWKFLRESKCRRSFVSVTDRAANAYDVCVIGGGHAGCEAAAASARTGARTLLLTQKLDTIGELSCNPSIGGVGKGTLVREIDALDGLMGRVSDKAGIQFYVLNRPKGAAVWDSSSNREKVIQEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.78
4 0.8
5 0.75
6 0.71
7 0.7
8 0.62
9 0.61
10 0.63
11 0.57
12 0.51
13 0.51
14 0.48
15 0.4
16 0.38
17 0.3
18 0.2
19 0.15
20 0.12
21 0.09
22 0.08
23 0.08
24 0.06
25 0.05
26 0.07
27 0.06
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.03
35 0.04
36 0.04
37 0.04
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.08
45 0.09
46 0.13
47 0.15
48 0.15
49 0.15
50 0.16
51 0.16
52 0.15
53 0.13
54 0.09
55 0.06
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.07
70 0.07
71 0.09
72 0.08
73 0.07
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.05
80 0.05
81 0.04
82 0.05
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.06
89 0.08
90 0.09
91 0.1
92 0.1
93 0.13
94 0.14
95 0.24
96 0.28
97 0.27
98 0.26
99 0.27
100 0.27
101 0.25
102 0.27
103 0.19
104 0.18
105 0.21
106 0.27
107 0.29
108 0.33
109 0.37
110 0.35
111 0.33
112 0.34