Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0Y2B9

Protein Details
Accession A0A4U0Y2B9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
87-111ILPGSKAPGRQRRMQRRKEERQGRABasic
NLS Segment(s)
PositionSequence
77-111RKVKVKKPMRILPGSKAPGRQRRMQRRKEERQGRA
Subcellular Location(s) plas 9, mito 5, E.R. 5, cyto 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEPQVNPVYDSAATAILRALGWFLPLLATVTALNSRYLFVAICPLVLVGALLFTLPSTGLFQRFMAAADPERADLNRKVKVKKPMRILPGSKAPGRQRRMQRRKEERQGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.1
5 0.09
6 0.09
7 0.06
8 0.06
9 0.06
10 0.06
11 0.05
12 0.06
13 0.07
14 0.06
15 0.07
16 0.06
17 0.07
18 0.09
19 0.09
20 0.1
21 0.09
22 0.1
23 0.09
24 0.1
25 0.09
26 0.07
27 0.1
28 0.09
29 0.09
30 0.08
31 0.08
32 0.07
33 0.07
34 0.06
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.03
44 0.04
45 0.05
46 0.07
47 0.08
48 0.08
49 0.08
50 0.09
51 0.09
52 0.08
53 0.09
54 0.09
55 0.1
56 0.1
57 0.1
58 0.11
59 0.11
60 0.14
61 0.19
62 0.23
63 0.28
64 0.33
65 0.37
66 0.43
67 0.54
68 0.59
69 0.61
70 0.65
71 0.67
72 0.69
73 0.73
74 0.7
75 0.66
76 0.66
77 0.64
78 0.57
79 0.57
80 0.58
81 0.59
82 0.61
83 0.63
84 0.65
85 0.71
86 0.79
87 0.82
88 0.84
89 0.85
90 0.91
91 0.94