Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0WX84

Protein Details
Accession A0A4U0WX84    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAAGKKQKKKWSKGKVKDKANHAVIHydrophilic
NLS Segment(s)
PositionSequence
7-22GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAAGKKQKKKWSKGKVKDKANHAVILDKNTAEKLAKDVQSYRLITVAVLVDRLKINGSLARKALADLEEKGTIKKVVAHNSGNIYTRAVGGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.92
7 0.88
8 0.85
9 0.83
10 0.75
11 0.66
12 0.56
13 0.52
14 0.43
15 0.4
16 0.33
17 0.24
18 0.21
19 0.18
20 0.19
21 0.14
22 0.12
23 0.12
24 0.17
25 0.18
26 0.19
27 0.21
28 0.24
29 0.29
30 0.29
31 0.25
32 0.2
33 0.18
34 0.17
35 0.16
36 0.12
37 0.06
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.08
46 0.1
47 0.13
48 0.14
49 0.15
50 0.16
51 0.15
52 0.15
53 0.16
54 0.14
55 0.14
56 0.13
57 0.16
58 0.18
59 0.18
60 0.19
61 0.19
62 0.18
63 0.16
64 0.21
65 0.23
66 0.29
67 0.34
68 0.36
69 0.38
70 0.42
71 0.45
72 0.41
73 0.36
74 0.29
75 0.24
76 0.22