Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WR66

Protein Details
Accession A0A4U0WR66    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
236-271ESEPLRVKEKTKRRQRKVKKVKSKHRYTILRIREVRBasic
NLS Segment(s)
PositionSequence
241-261RVKEKTKRRQRKVKKVKSKHR
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
Amino Acid Sequences MLSRNVKRALLDSRWPMPPTFLLPWSANFTAVSHAAEANNVPPPLLNAVQRVSPERPERRESRASPSAPPPPSPSSAPQLPAPHTTTSPPALSDSVRELLPVLQAQSPHYITAHLYDRPYLLTQGDTVRLPFFMKGVEPGDVLRLNRATVLGSREYTLKAAAPAPKLKSPTTSRTIILDPTTGSLASQSTVMPEPGVSASGSRLMAPHFVPHIAKGKVSYLDERLYVCRAVVMGVESEPLRVKEKTKRRQRKVKKVKSKHRYTILRIREVRVRGLEEIDGGVED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.47
4 0.42
5 0.38
6 0.36
7 0.34
8 0.3
9 0.29
10 0.29
11 0.31
12 0.34
13 0.32
14 0.27
15 0.23
16 0.22
17 0.21
18 0.21
19 0.19
20 0.13
21 0.14
22 0.13
23 0.14
24 0.14
25 0.13
26 0.16
27 0.15
28 0.14
29 0.13
30 0.14
31 0.18
32 0.2
33 0.2
34 0.18
35 0.19
36 0.21
37 0.23
38 0.27
39 0.25
40 0.3
41 0.37
42 0.43
43 0.47
44 0.52
45 0.55
46 0.58
47 0.64
48 0.6
49 0.6
50 0.6
51 0.57
52 0.54
53 0.56
54 0.57
55 0.5
56 0.49
57 0.45
58 0.41
59 0.42
60 0.4
61 0.37
62 0.35
63 0.35
64 0.35
65 0.34
66 0.34
67 0.33
68 0.34
69 0.34
70 0.29
71 0.27
72 0.27
73 0.25
74 0.24
75 0.22
76 0.18
77 0.17
78 0.17
79 0.16
80 0.16
81 0.16
82 0.15
83 0.14
84 0.13
85 0.12
86 0.11
87 0.12
88 0.11
89 0.1
90 0.1
91 0.1
92 0.12
93 0.15
94 0.14
95 0.14
96 0.13
97 0.12
98 0.11
99 0.14
100 0.16
101 0.14
102 0.14
103 0.14
104 0.14
105 0.15
106 0.15
107 0.13
108 0.1
109 0.09
110 0.1
111 0.1
112 0.11
113 0.1
114 0.1
115 0.1
116 0.1
117 0.1
118 0.09
119 0.08
120 0.06
121 0.06
122 0.08
123 0.09
124 0.09
125 0.08
126 0.08
127 0.1
128 0.11
129 0.11
130 0.11
131 0.1
132 0.09
133 0.09
134 0.09
135 0.08
136 0.08
137 0.11
138 0.11
139 0.11
140 0.11
141 0.12
142 0.12
143 0.12
144 0.11
145 0.09
146 0.08
147 0.11
148 0.14
149 0.16
150 0.2
151 0.22
152 0.24
153 0.27
154 0.26
155 0.3
156 0.32
157 0.35
158 0.35
159 0.35
160 0.33
161 0.33
162 0.33
163 0.29
164 0.25
165 0.19
166 0.15
167 0.13
168 0.13
169 0.1
170 0.09
171 0.07
172 0.07
173 0.06
174 0.07
175 0.06
176 0.07
177 0.08
178 0.08
179 0.08
180 0.07
181 0.08
182 0.08
183 0.08
184 0.07
185 0.06
186 0.07
187 0.09
188 0.1
189 0.09
190 0.09
191 0.09
192 0.12
193 0.12
194 0.13
195 0.12
196 0.14
197 0.14
198 0.17
199 0.23
200 0.21
201 0.22
202 0.21
203 0.23
204 0.25
205 0.27
206 0.27
207 0.23
208 0.24
209 0.25
210 0.25
211 0.24
212 0.23
213 0.2
214 0.17
215 0.14
216 0.12
217 0.11
218 0.1
219 0.09
220 0.08
221 0.08
222 0.1
223 0.09
224 0.1
225 0.12
226 0.13
227 0.16
228 0.17
229 0.23
230 0.31
231 0.42
232 0.51
233 0.61
234 0.71
235 0.77
236 0.87
237 0.93
238 0.94
239 0.95
240 0.96
241 0.96
242 0.96
243 0.97
244 0.96
245 0.96
246 0.94
247 0.93
248 0.91
249 0.88
250 0.87
251 0.85
252 0.84
253 0.77
254 0.72
255 0.69
256 0.62
257 0.6
258 0.54
259 0.49
260 0.4
261 0.39
262 0.35
263 0.28
264 0.26