Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WCW6

Protein Details
Accession A0A4U0WCW6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
89-108VKPTRPTKARKPKAPSPVKKBasic
NLS Segment(s)
PositionSequence
80-110SRDKHASSPVKPTRPTKARKPKAPSPVKKKP
Subcellular Location(s) nucl 16.5, cyto_nucl 11, pero 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
Amino Acid Sequences MESQGGPSQPDTTPAPPTSPPRREGPAEGILKTIMRLRGLSISEQSTFDFEPAQEWKRWPGARYGQDSPHLQYAKGTKSSRDKHASSPVKPTRPTKARKPKAPSPVKKKPAQPSTTHGVIPARDPPVHFLTLPPELRNRIYELIAVREGPHYPQVRPVWKPGKRRECSDRRFPLEPSLALANHQLREEMLSIFYGCNRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.32
4 0.41
5 0.47
6 0.48
7 0.49
8 0.48
9 0.53
10 0.53
11 0.53
12 0.5
13 0.49
14 0.46
15 0.43
16 0.39
17 0.34
18 0.3
19 0.26
20 0.24
21 0.17
22 0.15
23 0.15
24 0.16
25 0.2
26 0.22
27 0.23
28 0.21
29 0.21
30 0.21
31 0.22
32 0.21
33 0.18
34 0.17
35 0.15
36 0.13
37 0.11
38 0.12
39 0.16
40 0.19
41 0.19
42 0.2
43 0.23
44 0.3
45 0.32
46 0.3
47 0.34
48 0.39
49 0.43
50 0.48
51 0.49
52 0.44
53 0.46
54 0.47
55 0.41
56 0.39
57 0.33
58 0.27
59 0.26
60 0.27
61 0.27
62 0.32
63 0.3
64 0.29
65 0.38
66 0.43
67 0.48
68 0.5
69 0.48
70 0.46
71 0.56
72 0.57
73 0.5
74 0.56
75 0.54
76 0.53
77 0.54
78 0.53
79 0.52
80 0.53
81 0.57
82 0.58
83 0.62
84 0.65
85 0.7
86 0.75
87 0.73
88 0.75
89 0.8
90 0.79
91 0.77
92 0.79
93 0.78
94 0.76
95 0.75
96 0.74
97 0.73
98 0.68
99 0.61
100 0.56
101 0.55
102 0.51
103 0.43
104 0.35
105 0.27
106 0.23
107 0.22
108 0.21
109 0.18
110 0.16
111 0.17
112 0.2
113 0.21
114 0.22
115 0.2
116 0.17
117 0.18
118 0.24
119 0.25
120 0.22
121 0.22
122 0.23
123 0.25
124 0.26
125 0.25
126 0.21
127 0.2
128 0.22
129 0.2
130 0.21
131 0.2
132 0.19
133 0.16
134 0.15
135 0.16
136 0.15
137 0.2
138 0.19
139 0.19
140 0.27
141 0.33
142 0.38
143 0.4
144 0.47
145 0.51
146 0.55
147 0.65
148 0.68
149 0.72
150 0.7
151 0.76
152 0.77
153 0.78
154 0.79
155 0.8
156 0.79
157 0.75
158 0.74
159 0.68
160 0.66
161 0.6
162 0.52
163 0.44
164 0.39
165 0.32
166 0.29
167 0.34
168 0.29
169 0.26
170 0.26
171 0.23
172 0.19
173 0.21
174 0.22
175 0.16
176 0.13
177 0.13
178 0.13
179 0.13