Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WKJ8

Protein Details
Accession A0A4U0WKJ8    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
207-227KAPPPPRFPRLKKFKVKNIATHydrophilic
308-334PSMRLSKWFPGRRSKPPTPRKVKEGLLHydrophilic
NLS Segment(s)
PositionSequence
200-222QRNPPPHKAPPPPRFPRLKKFKV
317-328PGRRSKPPTPRK
Subcellular Location(s) nucl 13.5, cyto_nucl 8.5, mito 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MASRQDITTPYVLANKPSSSFSTVSSAASATSAATSRSGGSKLLFGEIDLSSDRSSESYASVCSFVLSDSGTFLKFWLEDKCRDTFLSHLPKDDLASLRLVGHDFGVRAAPALFSDLSITFKTGTFTRPARLAALDRLGFYVKTLRFSVPHTPETFLPPLVEPDTGEELSFTYTPQVTPCAGRPKYGDIANRVGADARAQRNPPPHKAPPPPRFPRLKKFKVKNIATPAADIQSFARSHKQTLEELDLEDTELTAGTWDEALSPLTRQARRRTSHACIPIMLSPTTLTAPRLAPMERVDSYLASSGRPSMRLSKWFPGRRSKPPTPRKVKEGLLGCEGQLKKVVAGVLAWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.28
4 0.3
5 0.32
6 0.29
7 0.3
8 0.28
9 0.29
10 0.28
11 0.27
12 0.24
13 0.21
14 0.16
15 0.16
16 0.13
17 0.08
18 0.09
19 0.09
20 0.09
21 0.09
22 0.1
23 0.11
24 0.14
25 0.14
26 0.14
27 0.15
28 0.17
29 0.17
30 0.19
31 0.17
32 0.14
33 0.16
34 0.15
35 0.16
36 0.14
37 0.15
38 0.12
39 0.13
40 0.13
41 0.1
42 0.11
43 0.1
44 0.11
45 0.1
46 0.11
47 0.13
48 0.13
49 0.12
50 0.11
51 0.11
52 0.09
53 0.09
54 0.08
55 0.07
56 0.08
57 0.09
58 0.1
59 0.09
60 0.09
61 0.1
62 0.1
63 0.12
64 0.18
65 0.22
66 0.26
67 0.29
68 0.32
69 0.32
70 0.33
71 0.32
72 0.27
73 0.32
74 0.38
75 0.35
76 0.35
77 0.35
78 0.34
79 0.34
80 0.34
81 0.26
82 0.17
83 0.17
84 0.15
85 0.15
86 0.15
87 0.14
88 0.11
89 0.1
90 0.1
91 0.09
92 0.08
93 0.09
94 0.08
95 0.08
96 0.08
97 0.07
98 0.06
99 0.08
100 0.07
101 0.07
102 0.08
103 0.08
104 0.1
105 0.1
106 0.11
107 0.1
108 0.1
109 0.12
110 0.11
111 0.13
112 0.16
113 0.17
114 0.18
115 0.2
116 0.2
117 0.2
118 0.21
119 0.21
120 0.18
121 0.21
122 0.19
123 0.17
124 0.17
125 0.17
126 0.15
127 0.13
128 0.17
129 0.14
130 0.16
131 0.17
132 0.17
133 0.18
134 0.21
135 0.3
136 0.28
137 0.31
138 0.3
139 0.3
140 0.29
141 0.33
142 0.3
143 0.22
144 0.18
145 0.14
146 0.15
147 0.14
148 0.14
149 0.09
150 0.1
151 0.13
152 0.12
153 0.12
154 0.1
155 0.09
156 0.1
157 0.1
158 0.08
159 0.06
160 0.06
161 0.07
162 0.07
163 0.09
164 0.08
165 0.09
166 0.13
167 0.22
168 0.22
169 0.23
170 0.24
171 0.27
172 0.3
173 0.32
174 0.31
175 0.25
176 0.29
177 0.29
178 0.27
179 0.23
180 0.2
181 0.16
182 0.16
183 0.17
184 0.17
185 0.18
186 0.19
187 0.23
188 0.31
189 0.37
190 0.4
191 0.42
192 0.45
193 0.51
194 0.6
195 0.67
196 0.66
197 0.72
198 0.72
199 0.72
200 0.76
201 0.74
202 0.75
203 0.75
204 0.77
205 0.77
206 0.78
207 0.8
208 0.81
209 0.78
210 0.76
211 0.73
212 0.69
213 0.59
214 0.53
215 0.44
216 0.35
217 0.31
218 0.24
219 0.16
220 0.14
221 0.14
222 0.14
223 0.2
224 0.2
225 0.21
226 0.25
227 0.27
228 0.25
229 0.28
230 0.31
231 0.25
232 0.24
233 0.24
234 0.2
235 0.17
236 0.15
237 0.11
238 0.06
239 0.06
240 0.05
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.05
248 0.06
249 0.07
250 0.07
251 0.12
252 0.19
253 0.24
254 0.29
255 0.38
256 0.47
257 0.5
258 0.57
259 0.59
260 0.59
261 0.63
262 0.65
263 0.57
264 0.49
265 0.47
266 0.43
267 0.39
268 0.32
269 0.24
270 0.17
271 0.17
272 0.17
273 0.16
274 0.13
275 0.13
276 0.14
277 0.15
278 0.17
279 0.16
280 0.18
281 0.19
282 0.24
283 0.22
284 0.24
285 0.23
286 0.21
287 0.21
288 0.23
289 0.21
290 0.16
291 0.16
292 0.19
293 0.2
294 0.21
295 0.22
296 0.26
297 0.31
298 0.38
299 0.44
300 0.48
301 0.57
302 0.63
303 0.67
304 0.7
305 0.72
306 0.75
307 0.79
308 0.8
309 0.81
310 0.84
311 0.88
312 0.88
313 0.88
314 0.85
315 0.83
316 0.77
317 0.74
318 0.71
319 0.65
320 0.59
321 0.53
322 0.45
323 0.46
324 0.41
325 0.34
326 0.31
327 0.27
328 0.22
329 0.23
330 0.24
331 0.16