Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0W0Q9

Protein Details
Accession A0A4U0W0Q9    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-45APNPQKPAKANKSKSKKSQEGDHydrophilic
NLS Segment(s)
PositionSequence
6-40RRSGRATKGHHAKASSSPAPNPQKPAKANKSKSKK
Subcellular Location(s) nucl 22, cyto 2, mito 1, cysk 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR011011  Znf_FYVE_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00628  PHD  
Amino Acid Sequences MSEEPRRSGRATKGHHAKASSSPAPNPQKPAKANKSKSKKSQEGDADEDDGYVRCICGDGNDPRDKRPFIGCEACLAWQHNICMGMPVDEEDIPDHYLCEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.68
3 0.63
4 0.57
5 0.53
6 0.55
7 0.5
8 0.42
9 0.38
10 0.44
11 0.51
12 0.5
13 0.51
14 0.48
15 0.5
16 0.53
17 0.61
18 0.61
19 0.63
20 0.69
21 0.73
22 0.77
23 0.78
24 0.83
25 0.82
26 0.8
27 0.71
28 0.72
29 0.68
30 0.63
31 0.58
32 0.5
33 0.42
34 0.33
35 0.31
36 0.22
37 0.16
38 0.11
39 0.07
40 0.06
41 0.04
42 0.04
43 0.04
44 0.05
45 0.11
46 0.14
47 0.21
48 0.28
49 0.29
50 0.32
51 0.37
52 0.37
53 0.34
54 0.35
55 0.31
56 0.3
57 0.35
58 0.32
59 0.3
60 0.31
61 0.3
62 0.27
63 0.26
64 0.23
65 0.19
66 0.19
67 0.18
68 0.18
69 0.16
70 0.17
71 0.15
72 0.14
73 0.12
74 0.13
75 0.14
76 0.13
77 0.13
78 0.12
79 0.14
80 0.14
81 0.14